close

SimulationCraft 406-20

for World of Warcraft 4.0.6 Live (build level 13623)

Table of Contents

Raid Summary

DPS Chart DPS Chart Gear Chart Gear Chart Timeline Distribution Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Death_Knight_Unholy_1h_T11_372 : 23196dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
23196.4 12.67 / 0.05% 3486.4 6.7 6.7 runic_power 20.29% 50.0
Origin http://chardev.org/?profile=34574
Talents http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
Glyphs
  • horn_of_winter
  • raise_dead
  • death_and_decay
  • death_coil

Charts

http://9.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:53558|14410|9930|9488|6396|6385|5980|5927|2330|2083|1297|831&chds=0,107116&chco=9482C9,9482C9,336600,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++53558++death_and_decay,9482C9,0,0,15|t++14410++death_coil,9482C9,1,0,15|t++9930++gargoyle_strike,336600,2,0,15|t++9488++festering_strike,C79C6E,3,0,15|t++6396++scourge_strike,C79C6E,4,0,15|t++6385++sweeping_claws,C79C6E,5,0,15|t++5980++plague_strike,C79C6E,6,0,15|t++5927++icy_touch,2459FF,7,0,15|t++2330++melee,C79C6E,8,0,15|t++2083++melee_main_hand,C79C6E,9,0,15|t++1297++melee_off_hand,C79C6E,10,0,15|t++831++melee,C79C6E,11,0,15&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:16,10,10,9,9,8,7,6,6,5,5,4,4,2,0,0,0,0&chds=0,100&chco=9482C9,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,9482C9,C79C6E,336600,C79C6E,2459FF,C79C6E,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|melee|sweeping_claws|scourge_strike|melee_main_hand|death_and_decay|scourge_strike_shadow|blood_plague|melee_off_hand|gargoyle_strike|claw|frost_fever|festering_strike|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:RdsMFQdnvxwz6743554443467876654320zxwwwwxwusqpnnmlkjiihgfedcbaaZYXWWWWWVVVUUUUUUUVVVVVWWVVWWWXXXXXWWWWWWWWWWVVVVVVVUVVUUVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUVVUUUVVVVVVWVVVWWWWWWWWWWWXWVVVVVVVVVVVVVVVVWWWWWWWWWWWWWVVVVUUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVWWWWWVWWVVVVWVVVVVVVVVVVVVVVVVVVVUUUVVUUVVUUUVVVUUVWYabcdccbcbbaaaZZZZYYYYYYYYYYYZZaaaabbbcdeffggghggffeedcbaaaZZZZYYYYYXXXXXXXXXXXXXXXXXXWWVVVUVUUUUUUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=76&chtt=Death_Knight_Unholy_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uwyyz011222456877765420zxwvtsqppnmlkjihhgfgffeddccbaaZZYYYXXXXXXXXXYYYYYYYYYZZZZZYZYYYYYYYYYYYYYZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaababbbbbbbbbbabaaaZZYYYXXXXWWWWWWWWWWXXXXYYYYYZZZZZaaaaaabbbbcccddeeeffffgggggggfffefeeddddcccbbbbbbbbbbcbbbcbbbbbbbaaaaaZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYXXXXXXXXXXXXXXXXXXYXYYYYYYYYYYYYYYYYZZZZZaaaabbbbccccdddddddddddddddcccccccccccccccccdcdddddeeeeeffffffffgfggfffffffeeeddcccbbbaaaaZZZZZZZZZZZZZaaaaaabbbbbbbbbbbbbbbbbbbabbaab&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=23196|max=48442&chxp=1,1,48,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,5,7,6,13,27,29,61,64,107,134,192,250,304,361,437,463,527,570,611,580,622,650,574,542,480,418,397,313,300,246,178,134,119,70,70,41,37,23,10,12,4,4,3,1,0,0,0,1&chds=0,650&chbh=5&chxt=x&chxl=0:|min=21011|avg=23196|max=25948&chxp=0,1,44,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_1h_T11_372 23196
blood_plague 1412 6.1% 7.3 65.98sec 87478 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3634 7594 15.6% 0.0% 99.6%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.30 7.30 150.25 150.25 0.0000 3.0000 638922
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.38% 3633.88 2900 5300 460694
crit 23.5 15.62% 7593.67 6061 11077 178229

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 3.1 77.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.06 3.06 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 8.9 51.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.92 8.92 0.00 0.00 1.0170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1746 7.5% 14.5 32.27sec 54497 53558 0 0 0 15.6% 0.0% 0.0% 0.0% 242 2786 5825 15.7% 0.0% 50.3%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.49 14.49 242.10 242.10 1.0175 0.9401 789727
Direct Results Count Pct Average Min Max Total Damage
hit 12.2 84.37% 0.00 0 0 0
crit 2.3 15.63% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 204.2 84.35% 2786.37 2272 4141 568979
crit 37.9 15.65% 5824.53 4749 8654 220748

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:16
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3620 15.6% 112.8 3.96sec 14518 14410 11848 24768 34578 20.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
112.78 112.78 0.00 0.00 1.0075 0.0000 1637398
Direct Results Count Pct Average Min Max Total Damage
hit 89.5 79.34% 11848.31 9830 16544 1060197
crit 23.3 20.66% 24768.23 20546 34578 577201

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 302.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 905 3.9% 42.6 10.66sec 9624 9488 8644 17800 23285 10.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.55 42.55 0.00 0.00 1.0143 0.0000 409503
Direct Results Count Pct Average Min Max Total Damage
hit 38.0 89.30% 8644.43 7462 11303 328486
crit 4.6 10.70% 17799.79 15372 23285 81018

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 1003 4.3% 8.8 53.65sec 51819 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2578 5389 15.6% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.75 8.75 150.31 150.31 0.0000 3.0000 453585
Direct Results Count Pct Average Min Max Total Damage
hit 8.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.37% 2578.34 2055 3767 326974
crit 23.5 15.63% 5389.39 4295 7874 126610

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 37 0.2% 2.8 110.93sec 6016 5927 5145 10731 15729 15.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.78 2.78 0.00 0.00 1.0150 0.0000 16744
Direct Results Count Pct Average Min Max Total Damage
hit 2.3 84.42% 5145.26 4323 7526 12090
crit 0.4 15.58% 10730.80 9269 15729 4654

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2079 9.0% 260.4 1.74sec 3612 2083 4044 8330 11234 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
260.39 260.39 0.00 0.00 1.7346 0.0000 940612
Direct Results Count Pct Average Min Max Total Damage
hit 128.8 49.48% 4043.72 3414 5454 520960
crit 27.6 10.61% 8330.37 7033 11234 230073
glance 62.5 24.00% 3033.24 2560 4090 189579
miss 41.4 15.92% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1295 5.6% 259.6 1.74sec 2257 1297 2525 5201 7021 10.6% 15.9% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
259.59 259.59 0.00 0.00 1.7399 0.0000 585857
Direct Results Count Pct Average Min Max Total Damage
hit 128.5 49.51% 2525.24 2134 3408 324578
crit 27.6 10.63% 5201.19 4395 7021 143512
glance 62.2 23.95% 1894.31 1600 2556 117767
miss 41.3 15.91% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 6.0 81.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.97 5.97 0.00 0.00 1.0165 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 18 0.1% 1.3 131.97sec 6102 5980 5490 11309 14741 10.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.33 1.33 0.00 0.00 1.0203 0.0000 8139
Direct Results Count Pct Average Min Max Total Damage
hit 1.2 89.49% 5490.19 4831 7391 6554
crit 0.1 10.51% 11309.43 10136 14741 1586

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 2117 9.1% 147.7 3.04sec 6485 6396 5830 12011 15662 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.71 147.71 0.00 0.00 1.0138 0.0000 957845
Direct Results Count Pct Average Min Max Total Damage
hit 132.1 89.41% 5829.99 5042 7603 769946
crit 15.6 10.59% 12010.58 10387 15662 187898

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 1731 7.5% 147.7 3.04sec 5302 0 5302 0 12806 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.71 147.71 0.00 0.00 0.0000 0.0000 783156
Direct Results Count Pct Average Min Max Total Damage
hit 147.7 100.00% 5301.96 3028 12806 783156

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:6527.66
  • base_dd_max:6527.66
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.2 224.63sec 0 0 0 0 0 15.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.23 2.23 0.00 0.00 1.0054 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 1.9 84.22% 0.00 0 0 0
crit 0.4 15.78% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 355 1.5% 112.8 3.96sec 1426 0 0 0 0 0.0% 0.0% 0.0% 0.0% 407 395 0 0.0% 0.0% 90.0%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
112.78 112.78 407.05 407.05 0.0000 1.0000 160793
Direct Results Count Pct Average Min Max Total Damage
hit 112.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 407.0 100.00% 395.02 101 1410 160793

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:286.63
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1412
claw 605 42.8% 13.0 2.86sec 1628 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21165
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.84% 1491.43 1491 1491 17612
crit 1.2 9.16% 2982.86 2983 2983 3553

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 807 57.2% 23.0 1.48sec 1228 831 1189 2379 2379 9.2% 0.0% 23.8% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 1.4776 0.0000 28245
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 66.93% 1189.27 1189 1189 18308
crit 2.1 9.22% 2378.55 2379 2379 5045
glance 5.5 23.84% 891.95 892 892 4892

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1740
gargoyle_strike 1740 100.0% 46.7 6.52sec 11277 9930 11277 0 16064 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.71 46.71 0.00 0.00 1.1356 0.0000 526795
Direct Results Count Pct Average Min Max Total Damage
hit 46.7 100.00% 11277.02 8668 16064 526795

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 5604
claw 1060 18.9% 117.2 3.81sec 4090 0 3745 7491 11262 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.22 117.22 0.00 0.00 0.0000 0.0000 479463
Direct Results Count Pct Average Min Max Total Damage
hit 106.4 90.78% 3745.02 2746 5631 398488
crit 10.8 9.22% 7490.53 5492 11262 80975

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2327 41.5% 337.2 1.34sec 3122 2330 3026 6051 9221 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
337.24 337.24 0.00 0.00 1.3399 0.0000 1053002
Direct Results Count Pct Average Min Max Total Damage
hit 225.3 66.81% 3025.93 1861 4611 681730
crit 31.0 9.20% 6050.50 3722 9221 187678
glance 80.9 24.00% 2268.57 1396 3458 183594

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2216 39.6% 151.4 2.81sec 6621 6385 6063 12126 16633 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.44 151.44 0.00 0.00 1.0370 0.0000 1002692
Direct Results Count Pct Average Min Max Total Damage
hit 137.5 90.80% 6063.18 5273 8316 833728
crit 13.9 9.20% 12125.93 10545 16633 168964

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_1h_T11_372
death_coil runic_power 95.5% 569.4 25
summon_gargoyle runic_power 4.5% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 43.6% 102.3 40
sweeping_claws energy 56.4% 165.5 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.9 180.4 0.1 0.3%
horn_of_winter runic_power 18.1 180.9 10.0 0.0%
rune_abilities runic_power 220.8 2676.6 12.1 0.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 430.7 3.1 0.0%
pet - ghoul energy
energy_regen energy 1809.9 10667.4 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
dark_transformation 8.9 0.0 51.0sec 51.0sec 57% 57%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.5 45.0 48.6sec 8.2sec 83% 83%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 43.4 0.0 10.2sec 10.2sec 34% 34%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.3 38.4 50.6sec 9.3sec 37% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 28.2 0.2 15.7sec 15.6sec 4% 4%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.2 78.4 273.0sec 5.6sec 98% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.1 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.2 46.7 224.5sec 6.3sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.91%
σ of the average dps 6.3338
2 * σ / μ 0.0546%
95% Confidence Intervall ( μ ± 2σ ) ( 23183.73 - 23209.07 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 23177.40 - 23215.40 )
Sample Data
σ 633.3830
Minimum 21011.12
Maximum 25948.25
Spread ( max - min ) 4937.13
Range ( max - min ) / 2 2468.56
Range% 10.64
10th Percentile 22427.01
90th Percentile 24055.75
( 90th Percentile - 10th Percentile ) 1628.75
Approx. Iterations needed for
1% dps error 29
0.1% dps error 2982
0.1 scale factor error with delta=300 3565
0.05 scale factor error with delta=300 14263
0.01 scale factor error with delta=300 356599
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQTJJJN5PMMPPPMPRQRDNPLNPJJMPNOPMPPRPNQRPQRPPPPRRPPRUPQROQRPPPRUPPBARQDRPQRUORPPPRRPPQPRURPQRPNPPO5RSDPPRBCURQPRQPPRRPROPPRPRQPURQPPRPPPR9SDPRPQUROQRPPPRPPPRANPQRPUQRPPPROPSPPNRPQRDURQPPRPPPRPP5RURQORRQPPPRPPRSPPPRAUQRNDQROPPRPPPRUPQRTKLPPPMRPPPRNOQRUDQRRPPNPRPPPRPQRPQRRUPPPRNOPPRAPQR9PQGUPPPR5PPPNRDNQRNOQRRPPPPPPRRUPQRPQNRPPPNRPOPRUPQRRDNQNPPPRPPPRAPQRRPQRUOPPRPPPRPQRPUQRPPPROPPNRD7QNRUPQR5PPPRPPPRCAQRUORQPRPPPPPRUPRQPR9Q

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7000 5632 4914
Agility 721 138 20
Stamina 7621 6000 5825
Intellect 55 53 20
Spirit 85 85 20
Health 149663 127025 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.48% 18.48% 971
Spell Crit 12.45% 7.45% 1336
Spell Haste 12.35% 7.00% 896
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16794 12394 190
Melee Hit 11.08% 11.08% 971
Melee Crit 15.41% 8.02% 1336
Melee Haste 23.05% 7.00% 896
Expertise 27.04 27.04 812
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.08% 16.08% 1448

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 2
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 1
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 0
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_1h_T11_372
origin="http://chardev.org/?profile=34574"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
glyphs=horn_of_winter/raise_dead/death_and_decay/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
# Gear Summary # gear_strength=4914
# gear_agility=20
# gear_stamina=5825
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=812
# gear_hit_rating=971
# gear_crit_rating=1336
# gear_haste_rating=896
# gear_mastery_rating=1448
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_2h_T11_372 : 26597dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26597.4 13.75 / 0.05% 3714.1 7.2 7.2 runic_power 11.73% 55.1
Origin http://chardev.org/?profile=87453
Talents http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
Glyphs
  • blood_boil
  • pestilence
  • antimagic_shell
  • horn_of_winter
  • blood_tap
  • raise_ally
  • scourge_strike
  • raise_dead
  • death_coil

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:36034|13580|13333|10365|8974|8536|6431|5807|2774|2584|914&chds=0,72069&chco=9482C9,9482C9,C79C6E,336600,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E&chm=t++36034++death_and_decay,9482C9,0,0,15|t++13580++death_coil,9482C9,1,0,15|t++13333++festering_strike,C79C6E,2,0,15|t++10365++gargoyle_strike,336600,3,0,15|t++8974++scourge_strike,C79C6E,4,0,15|t++8536++plague_strike,C79C6E,5,0,15|t++6431++sweeping_claws,C79C6E,6,0,15|t++5807++icy_touch,2459FF,7,0,15|t++2774++melee_main_hand,C79C6E,8,0,15|t++2584++melee,C79C6E,9,0,15|t++914++melee,C79C6E,10,0,15&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:14,13,13,10,10,9,6,5,5,4,4,4,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,9482C9,9482C9,C79C6E,2459FF,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|scourge_strike_shadow|scourge_strike|melee_main_hand|melee|sweeping_claws|gargoyle_strike|festering_strike|blood_plague|death_and_decay|claw|frost_fever|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:QcpMENWfmmqv13224324644578766665432110000zyxwutssssrrrrqqpponnmlljjihgffeddcccbbaaaaaZZaZZZZaaaaaaaaaaaaaaaaaaaZZZZZZYYYYYYXXXXXXXXXWWWXWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXXXXXXYYYYYYYZaZXWWWWWWXXXYYZZaaabbccdddeeeeeddcbaaZZZYYYXXXXXXXWWWWWWWWWWWWWWWWWXXXXXXXXXYXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXXXXXXXXXXXXWWXWXWWWXXXXXXXXXXXXXXXXXXXXYYYYYYYYYZZZaaabcdefgghijkllllmlllkkjiihhgggggggggggghhghhhhhhhgfedddcbbaaaZZZYYYYYYYYYXXYXXXXXXYXXYYXXXXXXYYYXYYYXXYYXXXY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=80&chtt=Death_Knight_Unholy_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:vwyzz0011113567778755310zyxwvutsqponmljjjiihhggffeeddcccbbbbbbbbbbbbbbbbccccccccccbbbbbaaaabaaaaaaaaaaaaaaabbbbbbbbbbcccdddddeefeffefefeeeeeedcccbbaaaZZZZZZZYZZZZZZZZaaaaaabbbbbbccccddeeffgghhiiijjjkkkkkkkjjjjiihhhhgggffffeffefeeeefeeededddccccbbbbbbbbbbbbbbbbbbbbccccbbbbbbbbbbbbbbbbbabaaaaaaaaaaaaaZaZZZZZZZZZZZaZaaaaabbbcccccdcdddddddddddddddddddeeeeeffffggghhiiijjjkklllmmnnnnoooononnmmllkkjjihggfeedddcccbcbbbbbbbbbcbcbcccccccccccbbccccccccccccccc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26597|max=50929&chxp=1,1,52,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,4,3,5,6,13,22,49,36,46,81,105,165,221,253,342,373,463,513,564,605,615,623,631,591,575,508,464,420,329,320,272,204,140,147,97,69,43,40,10,12,9,5,2,1,2,1&chds=0,631&chbh=5&chxt=x&chxl=0:|min=23809|avg=26597|max=29250&chxp=0,1,51,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_2h_T11_372 26597
blood_plague 1332 5.0% 6.4 76.08sec 94328 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3518 7350 12.8% 0.0% 99.7%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.39 6.39 150.35 150.35 0.0000 3.0000 602556
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.21% 3517.52 2817 5142 461225
crit 19.2 12.79% 7349.88 5888 10746 141331

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 2.1 107.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.12 2.12 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.4 48.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.41 9.41 0.00 0.00 1.0125 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.4 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:60.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1183 4.4% 14.7 31.88sec 36506 36034 0 0 0 12.9% 0.0% 0.0% 0.0% 174 2702 5648 12.7% 0.0% 35.2%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.66 14.66 173.84 173.84 1.0131 0.9157 534996
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 87.14% 0.00 0 0 0
crit 1.9 12.86% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.7 87.27% 2702.49 2208 4017 410001
crit 22.1 12.73% 5648.46 4614 8395 124995

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:11
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3819 14.4% 126.3 3.54sec 13672 13580 11456 23944 33535 17.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
126.33 126.33 0.00 0.00 1.0067 0.0000 1727117
Direct Results Count Pct Average Min Max Total Damage
hit 103.9 82.26% 11455.94 9543 16045 1190392
crit 22.4 17.74% 23943.82 19946 33535 536725

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.97 1.97 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 1437 5.4% 48.2 9.41sec 13487 13333 12788 26341 33998 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.18 48.18 0.00 0.00 1.0116 0.0000 649884
Direct Results Count Pct Average Min Max Total Damage
hit 43.4 90.02% 12788.25 11218 16504 554708
crit 3.6 7.50% 26341.02 23109 33998 95175
dodge 1.2 2.48% 0.00 0 0 0

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $s2% weapon damage plus ${$m1*$m2/100} and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 977 3.7% 8.4 55.21sec 52333 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5390 12.8% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.44 8.44 150.36 150.36 0.0000 3.0000 441922
Direct Results Count Pct Average Min Max Total Damage
hit 8.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.22% 2579.93 2064 3777 338350
crit 19.2 12.78% 5390.32 4313 7894 103572

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 35 0.1% 2.7 115.59sec 5872 5807 5181 10802 15768 12.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.72 2.72 0.00 0.00 1.0113 0.0000 15959
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.71% 5181.25 4451 7545 12351
crit 0.3 12.29% 10802.28 9302 15768 3608

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2769 10.4% 195.3 2.32sec 6413 2774 6428 13235 17541 7.8% 2.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
195.29 195.29 0.00 0.00 2.3112 0.0000 1252305
Direct Results Count Pct Average Min Max Total Damage
hit 128.6 65.83% 6427.84 5531 8515 826330
crit 15.2 7.76% 13234.87 11394 17541 200549
glance 46.8 23.95% 4819.57 4148 6386 225426
dodge 4.8 2.46% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.7 86.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.73 5.73 0.00 0.00 1.0137 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 13 0.0% 0.7 146.21sec 8682 8536 8237 17003 21701 7.3% 2.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.68 0.68 0.00 0.00 1.0171 0.0000 5878
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 90.40% 8237.46 7458 10858 5041
crit 0.0 7.27% 17003.11 15364 21701 837
dodge 0.0 2.33% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 3416 12.8% 170.4 2.63sec 9070 8974 8596 17716 22804 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
170.36 170.36 0.00 0.00 1.0107 0.0000 1545122
Direct Results Count Pct Average Min Max Total Damage
hit 153.3 89.97% 8596.38 7546 11070 1317614
crit 12.8 7.54% 17716.05 15545 22804 227508
dodge 4.2 2.49% 0.00 0 0 0

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus ${$m1*$m2/100}. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 3513 13.2% 166.1 2.70sec 9566 0 9566 0 23453 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
166.12 166.12 0.00 0.00 0.0000 0.0000 1589068
Direct Results Count Pct Average Min Max Total Damage
hit 166.1 100.00% 9565.93 7760 23453 1589068

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:8013.99
  • base_dd_max:8013.99
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.7 195.56sec 0 0 0 0 0 13.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0056 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 86.98% 0.00 0 0 0
crit 0.4 13.02% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 375 1.4% 126.3 3.54sec 1341 0 0 0 0 0.0% 0.0% 0.0% 0.0% 410 413 0 0.0% 0.0% 90.7%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
126.33 126.33 410.44 410.44 0.0000 1.0000 169416
Direct Results Count Pct Average Min Max Total Damage
hit 126.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 410.4 100.00% 412.77 97 1368 169416

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:290.34
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1562
claw 651 41.7% 14.0 2.62sec 1628 0 1491 2983 2983 9.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 0.0000 0.0000 22786
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 90.87% 1491.43 1491 1491 18974
crit 1.3 9.13% 2982.86 2983 2983 3813

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 911 58.3% 26.0 1.34sec 1226 914 1189 2379 2379 9.2% 0.0% 24.2% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.00 26.00 0.00 0.00 1.3426 0.0000 31889
Direct Results Count Pct Average Min Max Total Damage
hit 17.3 66.59% 1189.27 1189 1189 20589
crit 2.4 9.19% 2378.55 2379 2379 5681
glance 6.3 24.23% 891.95 892 892 5619

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1862
gargoyle_strike 1862 100.0% 62.2 5.92sec 11000 10365 11000 0 16107 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.20 62.20 0.00 0.00 1.0613 0.0000 684180
Direct Results Count Pct Average Min Max Total Damage
hit 62.2 100.00% 11000.42 8704 16107 684180

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 6094
claw 1034 17.0% 115.3 3.86sec 4058 0 3716 7431 11289 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.33 115.33 0.00 0.00 0.0000 0.0000 467952
Direct Results Count Pct Average Min Max Total Damage
hit 104.7 90.80% 3716.05 2755 5645 389149
crit 10.6 9.20% 7430.87 5511 11289 78803

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2581 42.4% 370.0 1.22sec 3156 2584 3057 6116 9243 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
369.97 369.97 0.00 0.00 1.2216 0.0000 1167617
Direct Results Count Pct Average Min Max Total Damage
hit 247.2 66.81% 3057.47 1867 4622 755715
crit 34.1 9.21% 6116.16 3734 9243 208307
glance 88.7 23.99% 2294.27 1400 3466 203595

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2478 40.7% 168.1 2.54sec 6668 6431 6107 12219 16673 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
168.14 168.14 0.00 0.00 1.0369 0.0000 1121216
Direct Results Count Pct Average Min Max Total Damage
hit 152.7 90.82% 6107.40 5291 8337 932619
crit 15.4 9.18% 12218.52 10581 16673 188597

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_2h_T11_372
death_coil runic_power 94.9% 561.8 24
summon_gargoyle runic_power 5.1% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 40.7% 101.4 40
sweeping_claws energy 59.3% 166.7 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.9 179.8 0.1 0.7%
horn_of_winter runic_power 15.3 153.4 10.0 0.0%
rune_abilities runic_power 243.5 2940.5 12.1 0.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 474.0 3.4 0.0%
pet - ghoul energy
energy_regen energy 1809.9 11259.6 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 5.6 0.0 86.4sec 86.4sec 18% 18%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
dark_transformation 9.4 0.0 48.3sec 48.3sec 60% 60%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.5 0.0 111.0sec 111.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.8 41.4 46.9sec 8.7sec 82% 82%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 47.6 0.0 9.3sec 9.3sec 38% 38%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.7 40.4 48.2sec 8.8sec 34% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 36.0 0.3 12.4sec 12.3sec 6% 6%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 87.9 252.0sec 5.0sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.5sec 180.5sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.7 62.2 196.1sec 5.7sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.67%
σ of the average dps 6.8757
2 * σ / μ 0.0517%
95% Confidence Intervall ( μ ± 2σ ) ( 26583.67 - 26611.17 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26576.79 - 26618.05 )
Sample Data
σ 687.5683
Minimum 23809.38
Maximum 29250.02
Spread ( max - min ) 5440.64
Range ( max - min ) / 2 2720.32
Range% 10.23
10th Percentile 25766.02
90th Percentile 27528.31
( 90th Percentile - 10th Percentile ) 1762.29
Approx. Iterations needed for
1% dps error 26
0.1% dps error 2673
0.1 scale factor error with delta=300 4202
0.05 scale factor error with delta=300 16808
0.01 scale factor error with delta=300 420222
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQNPPP5RPPPMPQMRDQRTJJJNPLMMKOPMPPPMMPLMMPLMMPPPPMPPPMRURPQRDQROPPPNPPRUPQRRPQRPPPRPPBARROQUPQRRPNDPPPNPNPQMRPQRUPPPRR5POSPPNPNPRQRPRQRPPPRPPUPRDQRPNQRNOPPRPPURPAP9QRPRQPPGPPPRNPPQORQRPNDNPPPPRNPRQRPUQRPPRPPOSPRPPPNQRPRUQPPRPR5DPPPRQRORQRNPPNPBAPPPMRPQMMNPPPPPMPQMQOMRDPNPPPPRRQPRQRPPPPRNPPPPQPPRROQPNPPPRPPRRQPTKLPMDPPNPMPPPMRQORUPPP9QNPPMRPPPA5GPQRQPURNPPPPOPRPRQDRQPPPPRPPPRUPRQRPQRPPORPPNPRPRUQRNPPPPQPRRQDPRPUROPSPRNPPBAPQRRNPPPPQRURPQRPNPNORPN7DPRPQU5RPQRRPPPRPSOPPRUPRQPRAQPPNPNRUDPPR9O

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7032 5662 4942
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.59% 18.59% 982
Spell Crit 9.56% 4.56% 818
Spell Haste 23.65% 17.76% 2274
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16866 12455 190
Melee Hit 8.18% 8.18% 982
Melee Crit 12.52% 5.13% 818
Melee Haste 35.42% 17.76% 2274
Expertise 16.12 16.12 484
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.26% 14.26% 1123

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 1
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 0
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 1
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 3
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 1
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_2h_T11_372
origin="http://chardev.org/?profile=87453"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
glyphs=blood_boil/pestilence/antimagic_shell/horn_of_winter/blood_tap/raise_ally/scourge_strike/raise_dead/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs=sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
# Gear Summary # gear_strength=4942
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=484
# gear_hit_rating=982
# gear_crit_rating=818
# gear_haste_rating=2274
# gear_mastery_rating=1123
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_1h_T11_372 : 25940dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25939.5 11.90 / 0.05% 2904.3 8.9 9.1 runic_power 0.98% 47.2
Origin http://chardev.org/?profile=75143
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:17054|16960|10136|4475|3608|2660|1786|1662|757&chds=0,34107&chco=2459FF,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++17054++howling_blast,2459FF,0,0,15|t++16960++obliterate,C79C6E,1,0,15|t++10136++frost_strike,2459FF,2,0,15|t++4475++blood_strike,C79C6E,3,0,15|t++3608++plague_strike,C79C6E,4,0,15|t++2660++melee_main_hand,C79C6E,5,0,15|t++1786++melee,C79C6E,6,0,15|t++1662++melee_off_hand,C79C6E,7,0,15|t++757++melee,C79C6E,8,0,15&chtt=Death_Knight_Frost_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,15,12,11,10,10,6,5,3,3,2,2,1,1,0,0,0,0&chds=0,100&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,2459FF,C79C6E,2459FF,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|howling_blast|obliterate_offhand|melee_main_hand|frost_strike_offhand|melee_off_hand|frost_fever|blood_plague|claw|melee|blood_strike|blood_strike_offhand|razorice|plague_strike|melee|plague_strike_offhand|claw&chtt=Death_Knight_Frost_1h_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:XXcnyzrw585226762x1641xvz21zwuw1zuqnpvxvsqqsttsrommorssrponoomlkklnoqrtuuutsstuvvuuttuvwwwvvvwxxyyzzyxxxxwvuttuuuuuttssttsqnmkkklmnopqqqrstttsssssstttsssrssstttssttvvvvuuuuuuuuuttuutsrqpoooopppqqqqrtuuuuuvvvvvvvvuuuuuuvuuuuuuuuutuuuuuttttsssssrponmmmmmnnoopqqqrrqrsssttuuuuuuvvuuuuuuuuuuuuttttttttttttttsrqonllkjjjjjkkllmnnnooppqqrsssttuvvwwwxxxyyyyyyyzz000z00001111111100zzzyyyyyyyyzzzzzzzzzzzzzz0000011112222222222222222111100zyxxwwvvuuutttstttssssss&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=85&chtt=Death_Knight_Frost_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz1223445557778766554320zyxwvutsrrrqppppooooonnnmmmmmlkkkkkjjjjjiiiiihhhhggggggffffffeeeddddccccccccdddddddeefffggggghhhgggggggggggggggffffffffeeeeeedddddcccccccccccccccccccbcccccccddddeeeeeffffggghhhhhhiiiijjjjjjkkkkkkkkkkkkjjjjjiiiihhhhhgghghhhhhhhhhhhhhhgggggffffeeeeddddddddddddddddddddcccccccccccccdddeeeffghhijjkkkllllllllllkkkjjjiiihhhhhhgggggggggfffffffffffgggghhiijjkklllmmmmmmmmmmllllkkkkjjjjjjjjkkkkklllllmmmmmmmmmmmmmmmmmmmllllllllkkkkkkkkk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25940|max=44749&chxp=1,1,58,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,4,1,2,2,6,13,15,29,57,66,102,146,188,277,336,412,451,544,642,670,668,682,698,676,574,568,438,408,304,274,220,154,122,93,51,40,20,18,11,7,2,5,1,0,1,0,1&chds=0,698&chbh=5&chxt=x&chxl=0:|min=23416|avg=25940|max=28597&chxp=0,1,49,100&chtt=Death_Knight_Frost_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T11_372 25940
blood_plague 904 3.5% 20.9 33.59sec 19604 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2314 4835 17.0% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.86 20.86 149.18 149.18 0.0000 3.0000 409014
Direct Results Count Pct Average Min Max Total Damage
hit 20.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 123.9 83.03% 2313.91 1588 3924 286623
crit 25.3 16.97% 4835.47 3318 8202 122392

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 436 1.7% 30.9 14.74sec 6391 4475 5670 11679 16445 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.88 30.88 0.00 0.00 1.4280 0.0000 197319
Direct Results Count Pct Average Min Max Total Damage
hit 27.2 88.00% 5669.62 3681 8084 154040
crit 3.7 12.00% 11678.63 7669 16445 43280

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_strike_offhand 273 1.1% 30.9 14.74sec 4004 0 3554 7319 10407 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.88 30.88 0.00 0.00 0.0000 0.0000 123614
Direct Results Count Pct Average Min Max Total Damage
hit 27.2 88.05% 3553.86 2300 4989 96616
crit 3.7 11.95% 7318.56 4765 10407 26997

Action details: blood_strike_offhand

Static Values
  • id:66215
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:425.34
  • base_dd_max:425.34
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 6.5 72.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.52 6.52 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.5 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 324.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.89 1.89 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1268 4.9% 74.5 6.10sec 7697 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3219 6729 17.0% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.53 74.53 150.36 150.36 0.0000 3.0000 573623
Direct Results Count Pct Average Min Max Total Damage
hit 74.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 83.02% 3219.11 2184 5418 401854
crit 25.5 16.98% 6728.99 4565 11323 171770

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 3994 15.4% 124.5 3.60sec 14510 10136 10768 22165 35638 32.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.51 124.51 0.00 0.00 1.4316 0.0000 1806619
Direct Results Count Pct Average Min Max Total Damage
hit 83.6 67.16% 10767.79 7636 17300 900418
crit 40.9 32.84% 22165.07 15731 35638 906201

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
frost_strike_offhand 2505 9.7% 124.5 3.60sec 9098 0 6752 13898 22279 32.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.51 124.51 0.00 0.00 0.0000 0.0000 1132777
Direct Results Count Pct Average Min Max Total Damage
hit 83.6 67.17% 6752.29 4775 10815 564701
crit 40.9 32.83% 13898.06 9836 22279 568076

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:runic_power
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:139.53
  • base_dd_max:139.53
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 3148 12.1% 68.7 6.55sec 20712 17054 18147 37941 63669 14.7% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.75 68.75 0.00 0.00 1.2145 0.0000 1423863
Direct Results Count Pct Average Min Max Total Damage
hit 57.3 83.42% 18147.26 12175 31515 1040676
crit 10.1 14.69% 37940.80 25446 63669 383187
miss 1.3 1.89% 0.00 0 0 0

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2657 10.2% 290.6 1.56sec 4136 2660 4705 9692 14771 12.0% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
290.56 290.56 0.00 0.00 1.5548 0.0000 1201659
Direct Results Count Pct Average Min Max Total Damage
hit 131.4 45.22% 4705.47 3408 7170 618203
crit 34.8 11.96% 9691.99 7021 14771 336873
glance 69.9 24.05% 3528.97 2556 5291 246583
miss 54.5 18.77% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1660 6.4% 289.9 1.56sec 2590 1662 2946 6067 9082 11.9% 18.7% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
289.92 289.92 0.00 0.00 1.5582 0.0000 750841
Direct Results Count Pct Average Min Max Total Damage
hit 131.4 45.32% 2945.86 2130 4481 387084
crit 34.6 11.94% 6066.74 4388 9082 210019
glance 69.6 23.99% 2209.96 1598 3361 153738
miss 54.3 18.74% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4375 16.9% 81.9 5.53sec 24169 16960 17133 35561 55431 38.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.88 81.88 0.00 0.00 1.4251 0.0000 1978850
Direct Results Count Pct Average Min Max Total Damage
hit 50.6 61.82% 17133.21 12282 26908 867215
crit 31.3 38.18% 35560.61 25300 55431 1111635

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
obliterate_offhand 2741 10.6% 81.9 5.53sec 15142 0 10741 22289 34644 38.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.88 81.88 0.00 0.00 0.0000 0.0000 1239742
Direct Results Count Pct Average Min Max Total Damage
hit 50.7 61.89% 10740.94 7676 16818 544305
crit 31.2 38.11% 22289.24 15813 34644 695438

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% offhand weapon damage plus a bonus. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:325.19
  • base_dd_max:325.19
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.2 67.16sec 0 0 0 0 0 0.0% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.22 7.22 0.00 0.00 1.2255 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.1 98.08% 0.00 0 0 0
miss 0.1 1.92% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.83 7.83 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 79 0.3% 6.9 66.13sec 5171 3608 4587 9450 14173 12.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.89 6.89 0.00 0.00 1.4333 0.0000 35643
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 87.99% 4587.25 3547 6972 27818
crit 0.8 12.01% 9449.75 7307 14173 7824

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 49 0.2% 6.9 66.13sec 3235 0 2874 5927 8857 11.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.89 6.89 0.00 0.00 0.0000 0.0000 22294
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.18% 2873.52 2216 4357 17463
crit 0.8 11.82% 5927.47 4566 8857 4831

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% offhand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:210.42
  • base_dd_max:210.42
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
razorice 252 1.0% 479.7 0.94sec 237 0 237 0 338 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
479.73 479.73 0.00 0.00 0.0000 0.0000 113908
Direct Results Count Pct Average Min Max Total Damage
hit 479.7 100.00% 237.44 179 338 113908

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:949.00
  • base_dd_max:1764.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
pet - army_of_the_dead_ghoul_8 1295
claw 558 43.1% 12.0 3.09sec 1628 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 19535
Direct Results Count Pct Average Min Max Total Damage
hit 10.9 90.85% 1491.43 1491 1491 16260
crit 1.1 9.15% 2982.86 2983 2983 3275

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 737 56.9% 21.0 1.62sec 1228 757 1189 2379 2379 9.3% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 21.00 0.00 0.00 1.6225 0.0000 25793
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 66.78% 1189.27 1189 1189 16679
crit 1.9 9.26% 2378.55 2379 2379 4627
glance 5.0 23.95% 891.95 892 892 4487

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1648
claw 938 56.9% 105.4 3.85sec 3652 0 3344 6691 8749 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
105.42 105.42 0.00 0.00 0.0000 0.0000 385042
Direct Results Count Pct Average Min Max Total Damage
hit 95.7 90.79% 3344.30 2497 4374 320096
crit 9.7 9.21% 6690.99 4993 8749 64945

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 710 43.1% 123.4 3.26sec 2364 1786 2292 4581 5847 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.38 123.38 0.00 0.00 1.3237 0.0000 291708
Direct Results Count Pct Average Min Max Total Damage
hit 82.4 66.77% 2291.51 1714 2923 188789
crit 11.3 9.19% 4580.71 3429 5847 51954
glance 29.7 24.04% 1718.55 1286 2192 50966

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_1h_T11_372
frost_strike runic_power 98.6% 453.4 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 91.3 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.9 89.0 0.0 1.6%
chill_of_the_grave runic_power 149.3 1465.6 9.8 1.8%
frost_presence runic_power 125.7 196.7 1.6 0.7%
horn_of_winter runic_power 3.3 33.3 10.0 0.0%
improved_frost_presence runic_power 21.4 14.2 0.7 0.2%
rune_abilities runic_power 147.0 2307.9 15.7 1.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 392.2 2.8 0.0%
pet - ghoul energy
energy_regen energy 668.0 3960.9 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 6.1 0.0 79.9sec 79.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
frost_presence 2.0 0.0 50.8sec 50.8sec 89% 86%

Database details

  • id:
  • cooldown name:buff_frost_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.9sec 394.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.8sec 104.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 48.3 2.7 9.3sec 8.8sec 13% 23%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.8sec 61.8sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 52.1 21.6 8.7sec 6.1sec 33% 75%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_razorice 1.0 478.7 0.0sec 0.9sec 100% 100%

Database details

  • id:
  • cooldown name:buff_rune_of_razorice
  • tooltip:(null)
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rune_of_the_fallen_crusader 10.8 30.9 42.4sec 10.7sec 75% 75%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.6 21.4 124.3sec 17.8sec 91% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 11% 12%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 54.1 8.2sec
runic_empowerment_wasted 1.9 107.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.46%
σ of the average dps 5.9508
2 * σ / μ 0.0459%
95% Confidence Intervall ( μ ± 2σ ) ( 25927.61 - 25951.41 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25921.66 - 25957.36 )
Sample Data
σ 595.0795
Minimum 23415.61
Maximum 28596.89
Spread ( max - min ) 5181.28
Range ( max - min ) / 2 2590.64
Range% 9.99
10th Percentile 25206.85
90th Percentile 26739.39
( 90th Percentile - 10th Percentile ) 1532.54
Approx. Iterations needed for
1% dps error 21
0.1% dps error 2105
0.1 scale factor error with delta=300 3147
0.05 scale factor error with delta=300 12590
0.01 scale factor error with delta=300 314772
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
3 presence,choose=unholy,if=buff.bloodlust.react
4 army_of_the_dead
5 snapshot_stats
6 blood_fury,time>=10
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 pillar_of_frost
A raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
B raise_dead,time>=15
C outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
D howling_blast,if=dot.frost_fever.remains<=2
E plague_strike,if=dot.blood_plague.remains<=2
F obliterate,if=frost=2&unholy=2
G obliterate,if=death=2
H obliterate,if=buff.killing_machine.react
I blood_tap,if=buff.killing_machine.react
J empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
K blood_strike,if=blood=2
L frost_strike,if=runic_power>=90&!buff.bloodlust.react
M frost_strike,if=runic_power>=95
N howling_blast,if=buff.rime.react
O howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
P obliterate
Q empower_rune_weapon,if=target.time_to_die<=45
R frost_strike
S howling_blast
T blood_tap
U blood_strike,if=death=0
V empower_rune_weapon
W horn_of_winter

Sample Sequence

0124789C3DEKPNRRAK6HNRPRPRIRPPRRVFHKMNRPNRKPMNPEMNMPLNPLKNLRPNORRKR2SWHNR9RUPNCRRPNHNRKPLNPLNKIGLLNPLREHNLRKPOLRRKPPNLRW9H6NLRCUPRRUHRPNRRPNRTKPNORREKPNPLNLPLHLNPB9LLRURPNRCKPNOLRPNPLNRPNLPIHLLNOLEKOLRPRPKNL69RPRRKPNPLNRPCNLRUPRRWUPNRRTPNPNLRURPNERORKP9NRRWRPNHRORRPNRUVFKCHLLNFGGLLNPIHLLNRPKNLPBE69LKLNHLPLPLNLPLNOLRPOKLCRPNOKLPLOLPLRRPIKNHR9RREUWRPNKPLRORUSRPNRSRWPRCURPNRPNR7OHNLHL6N9RRTKPNREORPNPLNKLRPRRKPNOLRUPNCPLNL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6983 5625 4957
Agility 721 138 20
Stamina 7574 5955 5780
Intellect 55 53 20
Spirit 85 85 20
Health 148991 126395 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 15.11% 15.11% 626
Spell Crit 13.79% 8.79% 1576
Spell Haste 17.66% 12.06% 1544
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16756 12380 190
Melee Hit 8.21% 8.21% 626
Melee Crit 16.75% 9.36% 1576
Melee Haste 12.06% 12.06% 1544
Expertise 26.91 26.91 808
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.94% 12.94% 886

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
tabard empty

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 3
Lichborne 0
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 3
Might of the Frozen Wastes 0
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_1h_T11_372
origin="http://chardev.org/?profile=75143"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
actions+=/presence,choose=unholy,if=buff.bloodlust.react
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
# Gear Summary # gear_strength=4957
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=808
# gear_hit_rating=626
# gear_crit_rating=1576
# gear_haste_rating=1544
# gear_mastery_rating=886
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_razorice

Death_Knight_Frost_2h_T11_372 : 25561dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25560.6 13.73 / 0.05% 2030.7 12.6 12.7 runic_power 7.96% 58.6
Origin http://chardev.org/?profile=61432
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://2.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:32396|20458|16791|8778|7300|3728|1774|854&chds=0,64793&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32396++obliterate,C79C6E,0,0,15|t++20458++frost_strike,2459FF,1,0,15|t++16791++howling_blast,2459FF,2,0,15|t++8778++blood_strike,C79C6E,3,0,15|t++7300++plague_strike,C79C6E,4,0,15|t++3728++melee_main_hand,C79C6E,5,0,15|t++1774++melee,C79C6E,6,0,15|t++854++melee,C79C6E,7,0,15&chtt=Death_Knight_Frost_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:32,26,15,11,4,3,3,3,3,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|claw|blood_plague|blood_strike|melee|plague_strike|melee|claw&chtt=Death_Knight_Frost_2h_T11_372+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:Tny782uu142ywy120yxxywuuuwvtssuxuqmoqqqooooppnnllkmmmkkiijklifdeehijihhhhhhggeeeeddccccdddcccccdcddccbbbaZZZZZZZZYXYYZYYXVSSSSTTTTVWZZZZYYXYYZYYXXXXYYYXWVXWYXXWWWWXYZXWVWWWWWWWWWXXYWWUTTTUUUVWXYXYYZabcbcaaZaZaZZZYYYYYZYYWXWXXXXWWWXXYXWVUUVVVWUUTSRSRSSTTUWWXWWWXXXYaaaaababaZZZZZZYYYYYZYYYXXXXXYXYXXXXXXVVUSSRSRRRRSUUVVVVVWVWWXWWWXZZaaaaaaaabaaaabbcbccdddeefffghghiiiiihgffefffffffffffeddcdcdccbbbcdddddccccccbaaabaaaaZZZZaZZYZYYYYXWVUUUUUUUVVVVVWWWWWWW&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=107&chtt=Death_Knight_Frost_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:xyz012334547677777666543210zyxvvuuttssrrrqrqqqqpppppppoooononnnnnnnmmlmllkklkkjjiihhhhgggffffefefefefffffffffggggggggghggggghhhhiiiiiiiiiiiiijihhhhggfffeeeedddddddddddddddddcdcddddeeeffffffgghhiijjjkjkkkkkkklklkkkkkkkkkkkkkkkkkkkjkkjjjjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhggggggggfffffffffeeeeeeeddddddcdcdddeeefffgghhiiiijjjkkkkkklklkkkkkkllllllllllllllkkkkkkkkkklkllmmmmnooppqqqqrqrqqqppppoonnnnmmmmmmmlmmmmmmmmmmmmmmmmlllllllllllllllllllmmmmmmnmnnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25561|max=41817&chxp=1,1,61,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,2,5,5,11,18,15,46,62,68,107,114,175,197,250,300,342,408,385,454,497,554,587,523,570,524,514,467,466,408,375,300,238,198,171,146,130,103,65,50,45,33,22,16,14,5,3,7,2&chds=0,587&chbh=5&chxt=x&chxl=0:|min=23205|avg=25561|max=27999&chxp=0,1,49,100&chtt=Death_Knight_Frost_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T11_372 25561
blood_plague 786 3.1% 14.2 33.15sec 25090 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149 2115 4418 11.5% 0.0% 99.0%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.16 14.16 149.29 149.29 0.0000 3.0000 355342
Direct Results Count Pct Average Min Max Total Damage
hit 14.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 132.1 88.48% 2114.69 1600 3431 279320
crit 17.2 11.52% 4418.47 3344 7170 76022

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_strike 785 3.1% 40.0 11.35sec 8869 8778 8303 17069 23664 6.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.03 40.03 0.00 0.00 1.0103 0.0000 355011
Direct Results Count Pct Average Min Max Total Damage
hit 37.4 93.45% 8303.40 6093 11487 310619
crit 2.6 6.50% 17068.76 12617 23664 44392
miss 0.0 0.05% 0.00 0 0 0

Action details: blood_strike

Static Values
  • id:45902
  • school:physical
  • resource:unknown
  • tree:blood
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus $. Damage is increased by ${($m3/$m2)*100}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:850.67
  • base_dd_max:850.67
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
blood_tap 0 0.0% 7.2 64.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.23 7.23 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.2 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.95 1.95 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 runic power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1023 4.0% 82.0 5.54sec 5639 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2735 5714 11.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
82.03 82.03 150.37 150.37 0.0000 3.0000 462615
Direct Results Count Pct Average Min Max Total Damage
hit 82.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.1 88.52% 2734.76 2067 4447 364020
crit 17.3 11.48% 5713.50 4321 9295 98595

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 8101 31.7% 177.9 2.52sec 20596 20458 15362 31589 47898 32.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
177.90 177.90 0.00 0.00 1.0068 0.0000 3664011
Direct Results Count Pct Average Min Max Total Damage
hit 120.3 67.64% 15361.88 12355 23251 1848534
crit 57.5 32.31% 31588.56 25451 47898 1815477
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% weapon damage plus ${$m1*$m2/100} as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
howling_blast 2795 10.9% 74.7 5.98sec 16918 16791 15342 32058 54048 9.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
74.72 74.72 0.00 0.00 1.0076 0.0000 1264056
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 90.57% 15342.40 11512 25860 1038257
crit 7.0 9.43% 32058.20 24061 54048 225799

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.4)} Frost damage to that foe, and ${(0.6*((($m2+$M2)/2)+($AP*0.4)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1151.87
  • base_dd_max:1251.62
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3722 14.6% 221.0 2.05sec 7616 3728 7557 15570 22335 6.4% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
221.01 221.01 0.00 0.00 2.0430 0.0000 1683283
Direct Results Count Pct Average Min Max Total Damage
hit 153.6 69.51% 7557.46 6202 10842 1160941
crit 14.2 6.44% 15570.27 12775 22335 221688
glance 53.0 24.00% 5668.43 4651 8132 300653
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 6665 26.1% 92.1 4.92sec 32743 32396 24387 50752 74903 31.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
92.06 92.06 0.00 0.00 1.0107 0.0000 3014296
Direct Results Count Pct Average Min Max Total Damage
hit 62.8 68.21% 24387.38 19728 36361 1531262
crit 29.2 31.74% 50752.01 40639 74903 1483035
miss 0.0 0.05% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $s2% weapon damage plus ${$m1*$m2/100}. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.32 7.32 0.00 0.00 1.0144 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.84 7.84 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.8 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 112 0.4% 6.8 66.53sec 7370 7300 6901 14218 20206 6.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.85 6.85 0.00 0.00 1.0095 0.0000 50475
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 93.48% 6901.29 6046 10076 44183
crit 0.4 6.46% 14217.60 12455 20206 6293
miss 0.0 0.06% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $% weapon damage plus $ and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 1446
claw 605 41.8% 13.0 2.78sec 1628 0 1491 2983 2983 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21165
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.66% 1491.43 1491 1491 17578
crit 1.2 9.25% 2982.86 2983 2983 3587
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 841 58.2% 24.0 1.44sec 1227 854 1189 2379 2379 9.2% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 29440
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.65% 1189.27 1189 1189 19024
crit 2.2 9.25% 2378.55 2379 2379 5279
glance 5.8 24.00% 891.95 892 892 5137
dodge 0.0 0.05% 0.00 0 0 0
miss 0.0 0.06% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1609
claw 898 55.8% 109.6 3.70sec 3363 0 3081 6163 7643 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
109.63 109.63 0.00 0.00 0.0000 0.0000 368660
Direct Results Count Pct Average Min Max Total Damage
hit 99.4 90.68% 3081.42 2184 3822 306337
crit 10.1 9.22% 6162.64 4368 7643 62323
dodge 0.0 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 711 44.2% 134.6 2.99sec 2170 1774 2104 4208 5107 9.2% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.58 134.58 0.00 0.00 1.2235 0.0000 292074
Direct Results Count Pct Average Min Max Total Damage
hit 89.8 66.70% 2104.24 1499 2553 188895
crit 12.4 9.23% 4208.13 2998 5107 52246
glance 32.3 23.98% 1578.01 1124 1915 50933
dodge 0.1 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_2h_T11_372
frost_strike runic_power 100.0% 643.6 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 84.1 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1809.9 89.7 0.0 0.9%
chill_of_the_grave runic_power 166.7 1644.7 9.9 1.4%
horn_of_winter runic_power 11.7 117.5 10.0 0.0%
improved_frost_presence runic_power 184.6 112.2 0.6 0.4%
might_of_the_frozen_wastes runic_power 99.4 979.8 9.9 1.4%
power_refund runic_power 0.1 2.7 28.8 0.0%
rune_abilities runic_power 184.6 2791.3 15.1 0.9%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 443.0 3.2 0.0%
pet - ghoul energy
energy_regen energy 668.1 4149.7 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 5.9 0.0 83.3sec 83.3sec 19% 19%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 108.3sec 108.3sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 67.0 3.1 6.7sec 6.4sec 16% 25%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.8 0.0 61.6sec 61.6sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 39.9 1.4 11.3sec 10.9sec 15% 53%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 7.5 60.6 60.9sec 6.6sec 90% 88%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 3.1 26.4 136.2sec 15.2sec 94% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 78.3 5.7sec
runic_empowerment_wasted 1.6 103.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.69%
σ of the average dps 6.8626
2 * σ / μ 0.0537%
95% Confidence Intervall ( μ ± 2σ ) ( 25546.84 - 25574.29 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25539.98 - 25581.16 )
Sample Data
σ 686.2640
Minimum 23205.11
Maximum 27999.01
Spread ( max - min ) 4793.90
Range ( max - min ) / 2 2396.95
Range% 9.38
10th Percentile 24706.13
90th Percentile 26470.15
( 90th Percentile - 10th Percentile ) 1764.02
Approx. Iterations needed for
1% dps error 28
0.1% dps error 2883
0.1 scale factor error with delta=300 4186
0.05 scale factor error with delta=300 16745
0.01 scale factor error with delta=300 418629
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J blood_strike,if=blood=2
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T blood_strike,if=death=0
U empower_rune_weapon
V horn_of_winter

Sample Sequence

0123678BEJLGHFLLMO5LJLMO9LJLMOLMLFFLLOLGDLLMOLMJLKOKOKNJKOKOKKQOMKOKM8OKJKBHFKOKMQQNNQOQTQUEJKOKQOMOKMGKKMOKGKMQDJGKQNQTNOKQQTQRNGKMQQ8TVOQOQQSF5MBNQQQTOQVQJOMOMKQQRQNTQOQRTNQDQVTQNQOMQRQNQ8QTGQOQNQNNQQAGQBJNQSFQOQQNQTTVQOMQOMQQOQOQNQNQDJQTQOMOQQRQV8QT5GQTQOHMBGKQOQNQQOJQTQOQVOQQNQORQNQNQOQNQTNDQVQT8QOMQOMKNQOQQTNHQOQQVOQOQBNQQOMQOMQTQOMNQNQQTOQOQVQGMGQNQQD8QO5QTAGMQQTUEFFKKMQOMKQNQSJOMOKBKQOQOMQOMQJOKNKNQQJOQOQQTVOMOKQQDQ8OMQQTTOQGQQOQJOQRVQSRNOQQOMQOBKOKQQJONQQTQVRGQQ6GGMKQ5QOMQ8QODQTQVTGMQQOQRNQHGQJNQTQOMQONQQTBQOMNQQTVQF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7661 6038 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150223 127557 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 8.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16895 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01% 15.01% 1257

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_2h_T11_372
origin="http://chardev.org/?profile=61432"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/blood_strike,if=blood=2
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/blood_strike,if=death=0
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard=tabard_of_ramkahen,ilevel=85
# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T11_372 : 26463dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26463.2 11.52 / 0.04% 21.8 1212.6 1199.7 mana 0.00% 41.4
Origin http://chardev.org/?profile=34049
Talents http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
Glyphs
  • focus
  • rebirth
  • starfall
  • mark_of_the_wild
  • unburdened_rebirth
  • dash
  • starsurge
  • insect_swarm
  • moonfire

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:88720|83037|74982|43298|41413|16982|16050|1929&chds=0,177439&chco=336600,69CCF0,69CCF0,336600,8AD0B1,69CCF0,336600,C79C6E&chm=t++88720++sunfire,336600,0,0,15|t++83037++moonfire,69CCF0,1,0,15|t++74982++starfall,69CCF0,2,0,15|t++43298++insect_swarm,336600,3,0,15|t++41413++starsurge,8AD0B1,4,0,15|t++16982++starfire,69CCF0,5,0,15|t++16050++wrath,336600,6,0,15|t++1929++treant_melee,C79C6E,7,0,15&chtt=Druid_Balance_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:24,23,16,12,11,7,6,1,0,0&chds=0,100&chco=336600,69CCF0,8AD0B1,69CCF0,336600,336600,69CCF0,C79C6E,336600,C41F3B&chl=wrath|starfire|starsurge|moonfire|insect_swarm|sunfire|starfall|treant_melee|wild_mushroom_detonate|darkmoon_card_volcano&chtt=Druid_Balance_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:n00zzyxxw05877665443100zzyyxxyz0zyxwvvuttttssssstvxyzzzzzyyxxxwwwvvuuutuuuuvwxxyxxwwvvuuttttsssstuvwxxyyyyyyyxxxwwvvvuuuuuuvvwwwwwwwwvvvuutttsssssttuvwxxyyyxxxwwwwvvuuuutttuuvvwwwwwwvvuutsssrrrrrsssttuuvvvvvvvuuuttsssssrssssttuuuuuutttsssrrrrrrrrssttttuuuuuuutttsssrrrrrrrrrssstttttttttsssrrrrrrrsssttttttttttttsssrrrrrrrrrrrssstttuuuuttttssssssssttttuuuuuutttttsssrrrqqqrrrssstttuuuuuuutttttttttttttttuuttttttssssrrrrrrrssttuuvvvvvvvvvuuuuuutttttttuuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=121206&chtt=Druid_Balance_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:wy34566665555774242345421zyxxwwuuutttsssrponmlmnmmmlmlmmmmmmlljjiiihgfffffffffeeffghhgggggggghhhhhhiijjjkkkkklllkkkjiijjjjjjjijjjjjjjjjjjjjjiiiiiihhhhggfggggggffffeeeeedddeefgghhijjklllllllmmnmmmmlllkkjjjjiijjjjjjijjjjjjjjjjkklmmnnnooonnnmllkkkkjjihhggffeeeddddddddddddeeffgghhiijkkllllllkkkjjihhhhggffffeeeeeeeeeffgghiijkklmnnoooooppppoonnmlkkjihhggffffffffffffgggghhijkllmmnnooooooonnnnnmllkjiihhggffeeeeeeeffffgghhijjklmmnoopppqqpppoonnmmllkkjjihhgg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26463|max=43412&chxp=1,1,61,100&chtt=Druid_Balance_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,4,6,12,14,24,36,46,85,105,150,189,253,337,351,448,492,598,622,605,629,611,618,547,557,480,425,387,302,246,190,165,120,94,75,61,41,31,21,9,7,3,0,0,0,0,2&chds=0,629&chbh=5&chxt=x&chxl=0:|min=24273|avg=26463|max=28860&chxp=0,1,48,100&chtt=Druid_Balance_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Balance_T11_372 26463
darkmoon_card_volcano 71 0.3% 10.2 46.40sec 3141 0 2682 4150 4884 31.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 32118
Direct Results Count Pct Average Min Max Total Damage
hit 7.0 68.50% 2681.71 2568 3161 18786
crit 3.2 31.41% 4150.40 3968 4884 13332
miss 0.0 0.09% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
insect_swarm 2854 10.8% 26.0 17.76sec 49677 43298 0 0 0 0.0% 0.1% 0.0% 0.0% 304 3415 5204 46.1% 0.0% 99.7%

Stats details: insect_swarm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.99 25.99 304.49 304.49 1.1473 1.4810 1291028
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 99.93% 0.00 0 0 0
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.1 53.88% 3414.81 2428 6467 560242
crit 140.4 46.12% 5204.18 3752 9992 730785

Action details: insect_swarm

Static Values
  • id:5570
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1490.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:$w1 Nature damage every $t1 sec.
  • description:The enemy target is swarmed by insects, causing $o1 Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:136.15
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
moonfire 3157 11.9% 15.4 30.22sec 92860 83037 4233 8903 15653 34.4% 0.1% 0.0% 0.0% 194 4600 9390 48.2% 0.0% 59.3%

Stats details: moonfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.38 15.38 193.73 193.73 1.1183 1.3855 1427952
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 65.55% 4233.43 2831 7489 42675
crit 5.3 34.37% 8903.30 5918 15653 47057
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.4 51.82% 4599.58 2960 8065 461751
crit 93.3 48.18% 9389.61 6186 16856 876468

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional ${$m1*6*$} Arcane damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 1640 6.2% 8.9 49.83sec 83691 74982 0 0 0 0.0% 0.0% 0.0% 0.0% 87 6406 13506 29.3% 0.1% 19.3%

Stats details: starfall

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.86 8.86 87.44 87.44 1.1161 1.0000 741908
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.7 70.59% 6406.39 4178 10875 395423
crit 25.7 29.34% 13506.22 8732 22730 346486
miss 0.1 0.07% 0.00 0 0 0

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
  • description:You summon a flurry of stars from the sky on all targets within 30 yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.247000
  • base_dd_min:368.70
  • base_dd_max:428.49

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • tree:balance
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6522.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster, each dealing $50288s1 Arcane damage. Maximum 20 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
starfire 5962 22.5% 81.9 5.43sec 32924 16982 20780 48216 81985 44.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.91 81.91 0.00 0.00 1.9388 0.0000 2696673
Direct Results Count Pct Average Min Max Total Damage
hit 45.5 55.61% 20779.92 14768 39227 946457
crit 36.3 44.32% 48215.86 30865 81985 1750216
miss 0.1 0.07% 0.00 0 0 0

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:986.98
  • base_dd_max:1230.95
starsurge 4283 16.2% 37.5 12.11sec 51672 41413 33077 76110 124966 43.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.49 37.37 0.00 0.00 1.2477 0.0000 1937147
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 56.28% 33077.01 22394 59792 695669
crit 16.3 43.65% 76110.15 46804 124966 1241478
miss 0.0 0.08% 0.00 0 0 0

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.535000
  • base_dd_min:1272.16
  • base_dd_max:1756.79
sunfire 1738 6.6% 7.8 57.13sec 100191 88720 4981 10493 15653 34.1% 0.1% 0.0% 0.0% 96 5330 11242 38.8% 0.0% 30.6%

Stats details: sunfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.84 7.84 96.03 96.03 1.1293 1.4423 785905
Direct Results Count Pct Average Min Max Total Damage
hit 5.2 65.87% 4980.58 4352 7489 25736
crit 2.7 34.05% 10492.63 9096 15653 28028
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 58.8 61.20% 5330.34 4549 8065 313284
crit 37.3 38.80% 11241.60 9508 16856 418858

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional ${$m1*4*$} Nature damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 82 0.3% 1.0 0.00sec 36969 0 31949 49361 49361 29.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 36969
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 70.94% 31948.58 31949 31949 22664
crit 0.3 28.98% 49360.55 49361 49361 14305
miss 0.0 0.08% 0.00 0 0 0

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.603200
  • base_dd_min:845.04
  • base_dd_max:1022.45
wrath 6291 23.8% 121.5 3.60sec 23410 16050 15282 34638 58192 42.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.54 121.16 0.00 0.00 1.4586 0.0000 2845384
Direct Results Count Pct Average Min Max Total Damage
hit 69.6 57.49% 15282.47 10437 27843 1064407
crit 51.4 42.44% 34637.69 21813 58192 1780976
miss 0.1 0.08% 0.00 0 0 0

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]$?s33891[ |C0033AA11Tree of Life: Cast time reduced by 50%, damage increased by 30%.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:675.17
  • base_dd_max:761.36
pet - treants 450
treant_melee 450 100.0% 60.8 6.39sec 2861 1929 3039 6096 7514 0.2% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: treant_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
60.78 60.78 0.00 0.00 1.4830 0.0000 173915
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 75.72% 3038.57 2755 3757 139841
crit 0.1 0.20% 6096.05 5510 7514 735
glance 14.6 24.06% 2279.96 2066 2818 33340
dodge 0.0 0.03% 0.00 0 0 0

Action details: treant_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.65
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Druid_Balance_T11_372
insect_swarm mana 6.8% 34.4 1445
moonfire mana 4.6% 57.1 1627
starfall mana 10.2% 13.2 6326
starfire mana 26.1% 18.8 1750
starsurge mana 12.3% 28.7 1800
sunfire mana 2.3% 61.6 1627
wrath mana 33.6% 15.4 1517
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29091.8 16.1 1.4%
euphoria mana 18.6 349581.5 18777.3 3.8%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101725.0 101725.0 0.0%
innervate mana 14.9 21282.2 1429.7 23.8%
mp5_regen mana 1809.9 83078.0 45.9 1.4%
omen_of_clarity none 21.5 41090.0 1907.3 0.0%
replenishment mana 1809.9 53744.2 29.7 1.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.2sec 104.2sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 220.3 0.0 2.0sec 2.0sec 78% 78%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
innervate 0.4 0.0 235.0sec 235.0sec 1% 100%

Database details

  • id:
  • cooldown name:buff_innervate
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
lunar_eclipse 9.1 0.0 49.4sec 49.4sec 27% 55%

Database details

  • id:48518
  • cooldown name:buff_lunar_eclipse
  • tooltip:Damage done by your arcane spells increased by $w1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_shower 23.2 0.0 19.9sec 19.9sec 15% 16%

Database details

  • id:81192
  • cooldown name:buff_lunar_shower
  • tooltip:Direct damage of your Moonfire increased by $s1%, and mana cost reduced by $s2%.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 19.4 0.0 23.9sec 23.9sec 63% 65%

Database details

  • id:
  • cooldown name:buff_natures_grace
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
omen_of_clarity 21.6 1.0 20.0sec 19.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
power_torrent_mh 10.1 0.0 47.1sec 47.1sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shooting_stars 22.1 1.7 19.9sec 18.4sec 9% 57%

Database details

  • id:93400
  • cooldown name:buff_shooting_stars
  • tooltip:Cast time of your next Starsurge reduced by $s1%.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:4.00%
solar_eclipse 9.6 0.0 48.7sec 48.7sec 32% 54%

Database details

  • id:48517
  • cooldown name:buff_solar_eclipse
  • tooltip:Damage done by your nature spells increased by $w1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_caster 18.6 0.0 24.4sec 24.4sec 24% 20%

Database details

  • id:
  • cooldown name:buff_t11_4pc_caster
  • tooltip:(null)
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
treants-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
moonkin_form

Database details

  • id:24858
  • cooldown name:buff_moonkin_form
  • tooltip:Arcane and Nature spell damage increased by $24905s3%. Immune to Polymorph effects. All damage reduced by $24905s1%. Spell haste of all party and raid members increased by $24907s1%
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
unaligned_eclipse_gain 0.3 162.9sec
wrong_eclipse_starfire 1.0 146.1sec
wrong_eclipse_wrath 3.4 97.9sec

Statistics & Data Analysis

DPS
Population
Convergence 69.87%
σ of the average dps 5.7611
2 * σ / μ 0.0435%
95% Confidence Intervall ( μ ± 2σ ) ( 26451.68 - 26474.73 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26445.92 - 26480.49 )
Sample Data
σ 576.1149
Minimum 24273.34
Maximum 28860.04
Spread ( max - min ) 4586.69
Range ( max - min ) / 2 2293.35
Range% 8.67
10th Percentile 25761.60
90th Percentile 27234.32
( 90th Percentile - 10th Percentile ) 1472.72
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1895
0.1 scale factor error with delta=300 2950
0.05 scale factor error with delta=300 11801
0.01 scale factor error with delta=300 295029
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 moonkin_form
4 snapshot_stats
5 volcanic_potion,if=!in_combat
6 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
7 faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
8 wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
9 berserking
A insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
B starsurge,if=buff.t11_4pc_caster.up
C starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
D wrath,if=buff.t11_4pc_caster.up
E wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
F wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
G typhoon,moving=1
H starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
I sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
J moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
K starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
L innervate,if=mana_pct<50
M treants,time>=5
N starfire,if=eclipse_dir=1&eclipse<80
O starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
P wrath,if=eclipse_dir=-1&eclipse>=-87
Q wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
R starfire,if=eclipse_dir=1
S wrath,if=eclipse_dir=-1
T starfire
U wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
V moonfire,moving=1
W sunfire,moving=1

Sample Sequence

013589AJKTTMNNNQBDKPKAPPIPPKPPPPPOCCAHNNJKNNNNQABDKPPIKPPKPPKASOCCCHJKNANNNKNQDDIPPAPPKPPPPPPJPOABCHNNNJKNNANNQDDKPIPAPPPPPPPKPCCAC9CHJKMNNNNNADDBIPPPPKPPPAPPPJSCBCHNANNJNNKNNQADDPPIPKPPPPPAPPPOBCCHJNANNNKNQDDIPAPPPPKPPPPPJPASBCHNNNJNAKNNNNQBDKIPAKP9PPPPMPPPPPCABHJNKNNNNNAKNJDDDKPPPPAPJPPPKPPOCACHNJNKNNNNARQBDIPPPPPPAPKPPPJPOCCAHKNNJNNNNQABD6KPPPIPPPPKAPPOCBCCHJANKN9N

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 699 117 20
Agility 693 111 20
Stamina 7588 5968 5862
Intellect 6013 5293 4595
Spirit 1765 1765 1591
Health 145435 122825 0
Mana 107575 97750 0
Spell Power 9031 7490 2207
Spell Hit 16.93% 16.93% 143
Spell Crit 24.46% 18.35% 778
Spell Haste 23.87% 17.97% 2301
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 1797 469 0
Melee Hit 1.19% 1.19% 143
Melee Crit 18.94% 12.15% 778
Melee Haste 17.97% 17.97% 2301
Expertise 0.00 0.00 0
Armor 14998 10922 10922
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 7.80% 5.41% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.35% 14.35% 1138

Gear

Encoded
head stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2 security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
tabard empty

Talents

Balance Rank
Nature's Grace 3
Starlight Wrath 3
Nature's Majesty 2
Genesis 3
Moonglow 1
Balance of Power 2
Euphoria 2
Moonkin Form 1
Typhoon 1
Shooting Stars 2
Owlkin Frenzy 0
Gale Winds 2
Solar Beam 0
Dreamstate 2
Force of Nature 1
Sunfire 1
Earth and Moon 1
Fungal Growth 0
Lunar Shower 3
Starfall 1
Feral Rank
Feral Swiftness 0
Furor 0
Predatory Strikes 0
Infected Wounds 0
Fury Swipes 0
Primal Fury 0
Feral Aggression 0
King of the Jungle 0
Feral Charge 0
Stampede 0
Thick Hide 0
Leader of the Pack 0
Brutal Impact 0
Nurturing Instinct 0
Primal Madness 0
Survival Instincts 0
Endless Carnage 0
Natural Reaction 0
Blood in the Water 0
Rend and Tear 0
Pulverize 0
Berserk 0
Restoration Rank
Blessing of the Grove 2
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 2
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Balance_T11_372
origin="http://chardev.org/?profile=34049"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
glyphs=focus/rebirth/starfall/mark_of_the_wild/unburdened_rebirth/dash/starsurge/insect_swarm/moonfire
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/moonkin_form
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
actions+=/berserking
actions+=/insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
actions+=/starsurge,if=buff.t11_4pc_caster.up
actions+=/starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
actions+=/wrath,if=buff.t11_4pc_caster.up
actions+=/wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/typhoon,moving=1
actions+=/starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
actions+=/sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
actions+=/moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
actions+=/starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
actions+=/innervate,if=mana_pct<50
actions+=/treants,time>=5
actions+=/starfire,if=eclipse_dir=1&eclipse<80
actions+=/starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
actions+=/wrath,if=eclipse_dir=-1&eclipse>=-87
actions+=/wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
actions+=/starfire,if=eclipse_dir=1
actions+=/wrath,if=eclipse_dir=-1
actions+=/starfire
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
actions+=/moonfire,moving=1
actions+=/sunfire,moving=1
head=stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
chest=scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist=belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs=stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet=nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists=manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands=stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2=security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5862
# gear_intellect=4595
# gear_spirit=1591
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=778
# gear_haste_rating=2301
# gear_mastery_rating=1138
# gear_armor=10922
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Druid_Feral_T11_372 : 25540dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25539.8 10.29 / 0.04% 1649.4 15.5 15.3 energy 47.28% 34.1
Origin http://chardev.org/?profile=35492
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:65891|33895|33222|21160|14015|4817&chds=0,131783&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++65891++rake,C55D54,0,0,15|t++33895++ferocious_bite,C79C6E,1,0,15|t++33222++ravage,C79C6E,2,0,15|t++21160++shred,C79C6E,3,0,15|t++14015++mangle_cat,C79C6E,4,0,15|t++4817++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:27,25,20,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|rake|cat_melee|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:puilu48700zzvsqoonmlkihgedbZXWXemolhdbYWVUUUUTTSSTTSSTTTTSVcggecZYWVUUUUUTTTSSSSSTTTTUYdffebZYXVVVUUUUTTTTSSSSSTTVYceedbZXWUUTTTTTTTTTTTTSSSTVZcddcbZYWVUTTTTTTTTTUUUUTTUWadeedcaZXWVUUTTTTTTTTTTTTTUWZcddccdeeeecbZYWVUTSRRRSSSUWYabbbaZYXWVVUUUUTTTTTTTTTUVYabcccbZYXWVVUUUUTTTTSSTTTUVXZabbbaYXWVUUUTTTTTTTTTTSTUVXZabbaZYXWVUUUTTTTTTTTTTTTUVXZabbaZYXWVVUUTTTTTTTTTTTTUVXYZaaZZXWWVUUUTTTTSSSSSTTTUVXYZZaabbbbaaYXWUTSRRRQQRRSTUWXYYYXXWVVUUTTTTTTTSSSSSTTUVXYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Druid_Feral_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qsuxyyyzz00124578765320zyxwwvvutsrppnnmmllkkjjihgggggghhhiiiijjjkkjjjjihhhhggghhhiiiiiiijjjjkkkkkjjihgggggghhiiiiiiiiiiiijjjjiihggfffffgghhhhhhhhhhhhhhhihhhhggggggghhijjjkkkkkjjjjjjjjjiihhhggggghhiijkkllmmmnnnoooooonnnnnmmmlllllkkkkkkjjjiiihhhhhhhhiiiiiiiiijjjjjjjjiihhggggghhhhiiiiiiiiiiijjjiiihhggggggghhhiiiiiiiiiiijjjjiiiihhhhiiijjkkkkkkkkkkkkkkkkjjiiiiiiiiiijjjjjjjjjjjjjjjiiiiiiiiiijjjkklmmnoppqqrrrrrrrrrrrrqqqqpppooonnnnmmmmllkkjjjijjjjjiijjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25540|max=41819&chxp=1,1,61,100&chtt=Druid_Feral_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,3,5,10,13,25,30,34,77,92,136,193,223,313,362,421,499,533,637,591,634,637,656,607,540,476,478,399,313,271,187,154,122,94,58,44,43,23,21,16,6,8,5,1,4,2,0,2&chds=0,656&chbh=5&chxt=x&chxl=0:|min=23616|avg=25540|max=27764&chxp=0,1,46,100&chtt=Druid_Feral_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372 25540
berserk 0 0.0% 2.8 195.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0166 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4815 18.9% 547.7 0.83sec 3977 4817 2921 6047 7505 49.5% 10.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.70 547.70 0.00 0.00 0.8256 0.0000 2178232
Direct Results Count Pct Average Min Max Total Damage
hit 85.7 15.65% 2920.93 1848 3643 250335
crit 271.0 49.49% 6046.87 3807 7505 1638902
glance 131.4 23.99% 2199.28 1386 2732 288995
dodge 35.6 6.50% 0.00 0 0 0
miss 24.0 4.37% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 859 3.4% 11.3 41.16sec 34525 33895 21228 44477 73912 67.1% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.25 11.25 0.00 0.00 1.0186 0.0000 388566
Direct Results Count Pct Average Min Max Total Damage
hit 2.5 22.07% 21227.66 2967 35880 52727
crit 7.6 67.09% 44477.26 6108 73912 335839
dodge 0.7 6.41% 0.00 0 0 0
miss 0.5 4.43% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 950 3.7% 51.7 8.72sec 8320 0 6108 12633 15510 44.1% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.66 51.66 0.00 0.00 0.0000 0.0000 429811
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 44.94% 6107.69 5729 7529 141799
crit 22.8 44.13% 12632.83 11801 15510 288012
dodge 3.4 6.51% 0.00 0 0 0
miss 2.3 4.42% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 704 2.8% 22.2 20.72sec 14377 14015 10520 21695 25644 44.7% 10.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.16 22.16 0.00 0.00 1.0258 0.0000 318634
Direct Results Count Pct Average Min Max Total Damage
hit 9.9 44.48% 10519.99 9610 12449 103705
crit 9.9 44.70% 21694.89 19797 25644 214929
dodge 1.4 6.48% 0.00 0 0 0
miss 1.0 4.34% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4998 19.6% 33.4 13.54sec 67608 65891 1883 3896 4670 44.3% 10.8% 0.0% 0.0% 146 9727 20123 49.5% 0.0% 96.1%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.44 33.44 146.25 146.25 1.0261 2.9720 2260864
Direct Results Count Pct Average Min Max Total Damage
hit 15.0 44.92% 1883.28 1778 2267 28292
crit 14.8 44.28% 3896.04 3663 4670 57688
dodge 2.2 6.46% 0.00 0 0 0
miss 1.4 4.34% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.9 50.51% 9726.50 9157 12018 718552
crit 72.4 49.49% 20123.37 18864 24756 1456332

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 74 0.3% 1.0 0.00sec 33517 33222 23022 47384 47613 53.6% 11.2% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0089 0.0000 33513
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 35.21% 23021.60 20098 23113 8106
crit 0.5 53.63% 47383.90 41403 47613 25407
dodge 0.1 6.69% 0.00 0 0 0
miss 0.0 4.47% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6827 26.7% 17.1 23.10sec 180510 176110 0 0 0 0.0% 10.9% 0.0% 0.0% 212 9499 19649 49.8% 0.0% 93.8%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.11 17.11 212.20 212.20 1.0250 2.0000 3088249
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 89.08% 0.00 0 0 0
dodge 1.1 6.53% 0.00 0 0 0
miss 0.8 4.39% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 106.5 50.21% 9499.22 8719 11527 1012037
crit 105.7 49.79% 19649.23 17962 23746 2076212

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.96 13.96 0.00 0.00 1.0260 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6313 24.7% 132.0 3.37sec 21631 21160 15888 32851 39324 44.1% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.02 132.02 0.00 0.00 1.0223 0.0000 2855749
Direct Results Count Pct Average Min Max Total Damage
hit 59.5 45.05% 15888.11 15022 19089 944981
crit 58.2 44.06% 32850.61 30946 39324 1910769
dodge 8.6 6.53% 0.00 0 0 0
miss 5.8 4.36% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.50 16.50 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372
feral_charge_cat energy 0.1% 0.0 10
ferocious_bite energy 6.7% 831.5 42
mangle_cat energy 10.2% 447.3 32
rake energy 14.3% 2258.3 30
rip energy 6.5% 6735.2 27
savage_roar energy 4.8% 0.0 24
shred energy 57.4% 710.6 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 88.8 565.2 6.4 0.0%
energy_regen energy 1809.9 4985.0 2.8 0.1%
omen_of_clarity none 28.3 1086.5 38.4 0.0%
tigers_fury energy 16.5 989.8 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.7sec 195.7sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 39.7 136.7 11.5sec 2.6sec 78% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 56.1sec 56.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 28.3 0.3 15.6sec 15.4sec 3% 4%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.4sec 81.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.8sec 23.8sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.8 8.1 80.9sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:42.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 28.0sec 28.0sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 75.1 7.8sec
fury_swipes 51.7 8.7sec
primal_fury 83.4 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.26%
σ of the average dps 5.1460
2 * σ / μ 0.0403%
95% Confidence Intervall ( μ ± 2σ ) ( 25529.49 - 25550.08 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25524.35 - 25555.22 )
Sample Data
σ 514.5955
Minimum 23615.80
Maximum 27763.90
Spread ( max - min ) 4148.10
Range ( max - min ) / 2 2074.05
Range% 8.12
10th Percentile 24903.35
90th Percentile 26204.93
( 90th Percentile - 10th Percentile ) 1301.58
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1623
0.1 scale factor error with delta=300 2353
0.05 scale factor error with delta=300 9415
0.01 scale factor error with delta=300 235385
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBBM9JRSSIIFSSSSPKSSSSSSSSSSB9KSISSMSSKSSIB9SMKSSSNSKSLSI9BBSSKSSSSIKS9MBSSSKSSSISK9SBSSMSLKSISS9KBSSLSSSSIKMSSQ9BKQSFISSLSSKMSSSSSB9SSIJSSSKISLB9SSMSKSSSISKS9BSSSKISMSKS9BSSSIKSSMSSSK9BISSSSKSMSSS9BIJSSSSKSSI9BSKMSFSSSSSLSHSKSHSBB9SSHKSSHSMKSSSB9HSSKSSMLSSGB9JSHSLSKNSSSG9ABBKSHSLSKNLSSS9BIKSS

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7051 5457 5366
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 4.26% 4.26% 436
Spell Crit 20.56% 15.54% 2222
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 24067 829 190
Melee Hit 3.63% 3.63% 436
Melee Crit 51.57% 37.66% 2222
Melee Haste 3.97% 3.97% 508
Expertise 0.00 0.00 0
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.65% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.98% 19.98% 2148

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372
origin="http://chardev.org/?profile=35492"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5366
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=436
# gear_crit_rating=2222
# gear_haste_rating=508
# gear_mastery_rating=2148
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Druid_Feral_T11_372_hitcap : 25493dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25492.5 10.09 / 0.04% 1737.3 14.7 14.5 energy 49.15% 33.0
Origin http://chardev.org/?profile=35430
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:68652|35438|35012|22027|14586|4884&chds=0,137304&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++68652++rake,C55D54,0,0,15|t++35438++ferocious_bite,C79C6E,1,0,15|t++35012++ravage,C79C6E,2,0,15|t++22027++shred,C79C6E,3,0,15|t++14586++mangle_cat,C79C6E,4,0,15|t++4884++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372_hitcap+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,19,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|cat_melee|rake|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372_hitcap+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:nqdhv584tttsokhffecbaZYWWVVUSSVenmhbYWUTTSTTSSRRRSSRRSSSSRVdgdaYVUUTTSTTSSSRRQRRSSSSSTZefdaXWVUTTSSSSSSSSSRQRRSSSUYddbZXWUSSSSSSSSSSSSSSRRRRSVZccbZXWVUSRRRRSSSSSSSSSSSSTXbddbaYWVUTTSSRRSSSSSSSSSSTUXabbbaabccbaYWUTSRQPPPPQQRSUWZaaZYXWUUTTTTSSSSRRRSSSSSTVYabaZYXWVUTTTSSSSSSRRRRRSSTVYZaZYXWVUTSSSSSSSSSSSSRRRSTVYZaZYXWVUTSSSSSSSSSSSSSSSSUWXZZZYXWVUTSSSRRRRRSSSSSSSTUVXYYYXWVUUTTSSSRRRRRRRRSSSTUVXYYYYYZZZYXWUTSQQPPOOPPQRSUVWWXWWVUTTSSSSSSSRSRRRRRRSTUWXXX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=73&chtt=Druid_Feral_T11_372_hitcap+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwyzzzzz1023458764321zywwvvutsrqponmmllkkjjihggffgfgggghhhiiijjjjjiiihhgggffgghhhhhhhhiiijjjjjjjihgffffffgghhhhhhhhhhhhiiiiihhgfeeeeeffggghhhhgggggghhhhhgggfffffgghhiijjjjjjjjiiijjiihhgggfffffgghhijjkklllmmmnnnnnmmmmmmlllkkkkkkjjjjjjiiihhhggggghhhhhhhhhiiiiiiiiiihhggffffggghhhhhhhhhhhhiiiiihhggffffffggghhhhhhhhhhhiiiiiihhhgggghhiijjjjkkkkkjjjjjjjjiihhhhhhhhhhiiiijjjjjjjiiiiihhhhhhhhiiijjkklmnooppqqqqqqqqqqqqqqpppoonnnmmmmmllllkjjiihhhiiiiiiiiijjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25493|max=42635&chxp=1,1,60,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,1,3,8,12,14,18,26,38,52,75,87,144,151,212,240,303,361,390,421,445,508,526,538,536,570,556,494,483,470,373,354,313,253,225,178,150,113,92,63,51,48,27,29,14,10,7,5,4,5&chds=0,570&chbh=5&chxt=x&chxl=0:|min=23770|avg=25493|max=27268&chxp=0,1,49,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372_hitcap 25493
berserk 0 0.0% 2.8 195.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.77 2.77 0.00 0.00 1.0170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4882 19.1% 547.8 0.83sec 4031 4884 2919 6037 7485 44.9% 3.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.77 547.77 0.00 0.00 0.8254 0.0000 2208336
Direct Results Count Pct Average Min Max Total Damage
hit 149.3 27.26% 2919.06 1843 3633 435854
crit 245.8 44.88% 6037.43 3796 7485 1484208
glance 131.3 23.98% 2195.00 1382 2725 288274
dodge 21.3 3.89% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 878 3.4% 11.0 43.16sec 36127 35438 21098 44361 73687 68.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.00 11.00 0.00 0.00 1.0194 0.0000 397223
Direct Results Count Pct Average Min Max Total Damage
hit 3.1 27.96% 21097.87 2957 35770 64855
crit 7.5 68.14% 44360.71 6090 73687 332368
dodge 0.4 3.90% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.2327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 1044 4.1% 54.5 8.27sec 8666 0 6093 12596 15468 43.2% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.50 54.50 0.00 0.00 0.0000 0.0000 472321
Direct Results Count Pct Average Min Max Total Damage
hit 28.8 52.84% 6093.38 5712 7509 175483
crit 23.6 43.24% 12596.08 11766 15468 296838
dodge 2.1 3.93% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s1% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 671 2.6% 20.2 22.83sec 15007 14586 10481 21621 25582 44.2% 3.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 0.00 0.00 1.0289 0.0000 303746
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 51.97% 10480.96 9586 12419 110249
crit 8.9 44.22% 21621.16 19746 25582 193496
dodge 0.8 3.81% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4866 19.1% 31.2 14.56sec 70581 68652 1888 3905 4676 43.1% 3.9% 0.0% 0.0% 147 9740 20157 44.9% 0.0% 96.6%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.19 31.19 146.89 146.89 1.0281 2.9739 2201368
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 52.97% 1888.03 1780 2270 31192
crit 13.4 43.10% 3904.95 3667 4676 52493
dodge 1.2 3.93% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 80.9 55.10% 9740.20 9160 12026 788382
crit 65.9 44.90% 20156.97 18870 24774 1329302

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 78 0.3% 1.0 0.00sec 35316 35012 23023 47426 47499 54.0% 3.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0087 0.0000 35316
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 42.24% 23022.94 20050 23058 9725
crit 0.5 53.96% 47425.64 41304 47499 25591
dodge 0.0 3.80% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6638 26.0% 15.8 24.88sec 189620 184633 0 0 0 0.0% 3.9% 0.0% 0.0% 213 9518 19693 45.2% 0.0% 94.1%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.84 15.84 212.79 212.79 1.0270 2.0000 3003076
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 96.13% 0.00 0 0 0
dodge 0.6 3.87% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 116.7 54.84% 9517.52 8726 11539 1110673
crit 96.1 45.16% 19693.37 17976 23771 1892403

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.96 13.96 0.00 0.00 1.0262 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6435 25.2% 129.1 3.45sec 22545 22027 15860 32802 39230 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
129.12 129.12 0.00 0.00 1.0235 0.0000 2910947
Direct Results Count Pct Average Min Max Total Damage
hit 68.4 53.01% 15859.94 14983 19043 1085532
crit 55.6 43.10% 32801.88 30865 39230 1825415
dodge 5.0 3.89% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.6 27.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.56 16.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.6 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372_hitcap
feral_charge_cat energy 0.2% 0.0 10
ferocious_bite energy 7.0% 860.6 42
mangle_cat energy 9.8% 468.2 32
rake energy 13.9% 2389.5 30
rip energy 6.3% 7134.8 27
savage_roar energy 5.1% 0.0 24
shred energy 57.8% 758.1 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 31.5 190.6 6.0 0.0%
energy_regen energy 1809.9 4986.5 2.8 0.0%
omen_of_clarity none 30.5 1173.4 38.4 0.0%
tigers_fury energy 16.6 993.8 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.4sec 195.4sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.2 138.7 11.4sec 2.5sec 79% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.7sec 55.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 30.6 0.4 14.5sec 14.3sec 3% 5%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.0sec 81.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.7sec 23.7sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 80.6sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:37.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.6 0.0 27.9sec 27.9sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 414.1sec 414.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.1 7.7sec
fury_swipes 54.5 8.3sec
primal_fury 78.6 5.7sec

Statistics & Data Analysis

DPS
Population
Convergence 71.13%
σ of the average dps 5.0454
2 * σ / μ 0.0396%
95% Confidence Intervall ( μ ± 2σ ) ( 25482.42 - 25502.60 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25477.37 - 25507.65 )
Sample Data
σ 504.5360
Minimum 23769.99
Maximum 27268.06
Spread ( max - min ) 3498.06
Range ( max - min ) / 2 1749.03
Range% 6.86
10th Percentile 24868.11
90th Percentile 26153.88
( 90th Percentile - 10th Percentile ) 1285.77
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1566
0.1 scale factor error with delta=300 2262
0.05 scale factor error with delta=300 9050
0.01 scale factor error with delta=300 226272
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBM9JRSISSFSSPSSKSSSSSSB9IKSSSSSMKSSISSB9SPKSSSSSIKKKM9BSSSKSISSSMKB9SSSSIKSSSSN9BJSISSKSSSS9BIKSLSSMKKSSI9BSSKFSSSSSSSSSSKISM9BSSKSLSISKSSM9BSSSKISSLPSK9BSSSSIKSMSSSSS9BKSISSSSKMSS9BKISSSSSKSSI9BSSMKSSLSKIS9BSSFSKNSSSSSISSSKB9SHSSKSSNSKB9SISSSHKSSNB9SSKHSSSHKSB9SHAKSMSSKGBS9SSHKSSO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7018 5427 5336
Stamina 7572 5953 5847
Intellect 201 192 20
Spirit 192 192 20
Health 145211 122615 0
Mana 24572 24400 0
Spell Power 210 182 0
Spell Hit 9.38% 9.38% 961
Spell Crit 16.02% 11.00% 1408
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 23967 829 190
Melee Hit 8.00% 8.00% 961
Melee Crit 46.93% 33.03% 1408
Melee Haste 3.97% 3.97% 508
Expertise 10.42 10.42 313
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.56% 24.22% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 20.18% 20.18% 2184

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372_hitcap
origin="http://chardev.org/?profile=35430"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5336
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=313
# gear_hit_rating=961
# gear_crit_rating=1408
# gear_haste_rating=508
# gear_mastery_rating=2184
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Hunter_BM_T11_372 : 28006dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28005.8 8.31 / 0.03% 2639.3 10.6 10.5 focus 0.00% 60.8
Origin http://chardev.org/?profile=34113
Talents http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
Glyphs
  • bestial_wrath
  • kill_command
  • arcane_shot
  • kill_shot

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31836|26076|16090|10221|7183|4310|2897&chds=0,63672&chco=C79C6E,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E&chm=t++31836++kill_command,C79C6E,0,0,15|t++26076++kill_shot,C79C6E,1,0,15|t++16090++arcane_shot,69CCF0,2,0,15|t++10221++cobra_shot,336600,3,0,15|t++7183++claw,C79C6E,4,0,15|t++4310++ranged,C79C6E,5,0,15|t++2897++melee,C79C6E,6,0,15&chtt=Hunter_BM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:19,18,17,15,13,10,4,3&chds=0,100&chco=69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=arcane_shot|cobra_shot|kill_command|ranged|claw|melee|serpent_sting|kill_shot&chtt=Hunter_BM_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x732zwwqmlpy1sqz233uqx123vrx123wqv023xrv023yrv024zsv024zsswz22ytsw122zurqnjhcXWVYgggntx1zuuxz21xuux120xtvz110vswz12zutwz22yvtw121zusx012yttxz20vsokieZXXclswusuz111vswz020ttwz21xuux110xtvz110vswz12zttwz21yutw011zurrokidYXWYdefmrvzzvvwz11zwuv0100vtxz01yuvxz20wvvx11zxvvz00zvuxz01yuvxz10wtpljfbZYbiptusuy001xuwy020wvwy11zxvwz000xvxz01zwwxz11yxwy220zyz2210yyzyvtqmkhffgjptvyxwyyz10xyyy11zzxxz000yxyzz10yyzz10zzyy00z0zyzzz10yzzz10yxurqolkiinqsvwwzzz10yzzz00&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=92&chtt=Hunter_BM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:62385543353302121zvvuuvupqqrqpmmnppommnooommnppommmmnnlllllmllmmmonnooppponnnnopnmmmmmlkkjjjkkjjkkklkkkkkkkjjjjkkkkkkkkkkkkkkkkkkkkllmmmmnooonnnnnonmmnnnmlkkkkkjiijjkkkjkkkllkkkkkllkkkkklkkkkkkkjjjjjjjjjkllmmmnnnoonmmmnnnnmmlllkkjiiijjjjkkkkkklllllllllllllkllllkkkkkkkkjjjkklllmnnooooooooonnnoonmlllkkkjjjjjkjkkkkkkkkkkkkkkkklllllllmmmnnnnoopppqqrsssttuuutssssssrrrqqpoonnmmmmmmmmmmmmmmmllllmmmmmmmmmmmmmmmmnnnnnnoppqrrsttuvvvvvvvvvvvuutssrqqqoopoopooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28006|max=42432&chxp=1,1,66,100&chtt=Hunter_BM_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,3,1,5,11,7,10,35,32,46,67,104,118,168,216,276,359,406,467,563,517,605,615,626,659,608,590,524,417,378,338,276,245,176,147,103,87,52,41,30,29,13,5,7,8,1,3,2,0,1&chds=0,659&chbh=5&chxt=x&chxl=0:|min=26477|avg=28006|max=29742&chxp=0,1,47,100&chtt=Hunter_BM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_BM_T11_372 28006
arcane_shot 5245 18.7% 146.2 3.08sec 16224 16090 11693 24242 31559 36.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.21 145.94 0.00 0.00 1.0083 0.0000 2372149
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 63.65% 11693.46 10837 15320 1086249
crit 53.0 36.35% 24242.41 22323 31559 1285900

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 70.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:70.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped unless killed.
cobra_shot 4916 17.6% 178.6 2.47sec 12449 10221 9031 18654 23032 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.56 178.22 0.00 0.00 1.2180 0.0000 2222984
Direct Results Count Pct Average Min Max Total Damage
hit 114.5 64.23% 9031.46 8766 11181 1033887
crit 63.7 35.77% 18653.77 18059 23032 1189098

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
fervor 0 0.0% 1.7 156.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fervor

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.71 1.71 0.00 0.00 1.0052 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.7 100.00% 0.00 0 0 0

Action details: fervor

Static Values
  • id:82726
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly restores $s1 Focus to you and your pet.
focus_fire 0 0.0% 25.7 17.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.65 25.65 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 25.7 100.00% 0.00 0 0 0

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy Effect stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy Effect stack consumed. Lasts for $d.
kill_command 4817 17.2% 68.0 6.68sec 32017 31836 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 68.0 100.00% 0.00 0 0 0

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:37.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Give the command to kill, causing your pet to instantly inflict $ damage to its target. Your Pet's happiness increases the damage done. The pet must be in combat and within 5 yards of the target to Kill Command.
kill_shot 953 3.4% 16.4 5.42sec 26235 26076 19050 39390 50516 36.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.42 16.28 0.00 0.00 1.0061 0.0000 430889
Direct Results Count Pct Average Min Max Total Damage
hit 10.3 63.52% 19050.35 17624 24522 196965
crit 5.9 36.48% 39389.72 36305 50516 233924

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 4304 15.4% 237.8 1.91sec 8185 4310 5905 12228 16284 36.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
237.79 237.79 0.00 0.00 1.8991 0.0000 1946232
Direct Results Count Pct Average Min Max Total Damage
hit 152.0 63.94% 5904.79 5607 7905 897803
crit 85.7 36.06% 12227.62 11551 16284 1048429

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1182 4.2% 1.0 0.00sec 534649 515585 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2908 4506 41.0% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.03 150.03 1.0370 3.0000 534702
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 88.4 58.95% 2908.03 2793 3927 257196
crit 61.6 41.05% 4506.14 4315 6067 277506

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - cat 11407
call_of_the_wild 0 0.0% 2.7 210.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.68 2.68 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:210.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 3694 32.4% 151.3 3.00sec 11040 7183 6633 13535 21379 63.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.31 151.31 0.00 0.00 1.5370 0.0000 1670378
Direct Results Count Pct Average Min Max Total Damage
hit 54.7 36.15% 6633.26 2885 10689 362821
crit 96.6 63.85% 13534.59 5712 21379 1307557

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
kill_command 4817 42.2% 68.0 6.68sec 32017 0 19713 39686 65182 61.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.04 68.04 0.00 0.00 0.0000 0.0000 2178326
Direct Results Count Pct Average Min Max Total Damage
hit 26.1 38.40% 19712.92 17460 32591 515004
crit 41.9 61.60% 39685.96 34919 65182 1663322

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.19
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:926.00
  • base_dd_max:926.00
melee 2896 25.4% 418.3 1.08sec 3130 2897 2137 4310 6505 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.32 418.32 0.00 0.00 1.0806 0.0000 1309436
Direct Results Count Pct Average Min Max Total Damage
hit 102.4 24.49% 2136.75 1910 3252 218869
crit 215.5 51.53% 4309.53 3819 6505 928882
glance 100.3 23.99% 1611.22 1432 2439 161686

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.3 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_BM_T11_372
arcane_shot focus 54.8% 901.6 18
kill_command focus 44.9% 1010.7 32
serpent_sting focus 0.3% 42771.9 12
pet - cat
claw focus 100.0% 336.2 33
Resource Gains Type Count focus Average Overflow
cobra_shot focus 178.6 1605.4 9.0 0.1%
fervor focus 1.7 85.4 50.0 0.0%
focus_regen focus 1809.9 2499.8 1.4 0.3%
invigoration focus 96.6 575.0 6.0 0.8%
pet - cat focus
fervor focus 1.7 35.0 20.5 59.0%
focus_fire focus 25.7 85.6 3.3 16.5%
focus_regen focus 1809.9 4074.2 2.3 14.0%
go_for_the_throat focus 85.7 724.0 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 6.9 0.0 70.6sec 70.6sec 15% 12%

Database details

  • id:34471
  • cooldown name:buff_beast_within
  • tooltip:Enraged.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_ap 4.3 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cobra_strikes 18.0 4.0 24.5sec 19.9sec 19% 26%

Database details

  • id:53257
  • cooldown name:buff_cobra_strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
culling_the_herd 6.6 90.0 69.1sec 4.7sec 94% 94%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.5sec 57.5sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
focus_fire 25.7 0.0 17.5sec 17.5sec 84% 84%

Database details

  • id:82692
  • cooldown name:buff_focus_fire
  • tooltip:Ranged haste increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
killing_streak 15.9 0.0 27.8sec 27.8sec 23% 22%

Database details

  • id:
  • cooldown name:buff_killing_streak
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 5.9 0.0 82.8sec 82.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.3sec 55.3sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bestial_wrath 6.9 0.0 70.6sec 70.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_bestial_wrath
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 6.6 90.0 69.1sec 4.7sec 94% 93%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-frenzy 26.6 124.8 17.3sec 3.0sec 89% 92%

Database details

  • id:
  • cooldown name:buff_frenzy
  • tooltip:(null)
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 14.3 0.0 32.9sec 32.9sec 62% 62%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 14.3 381.8 32.9sec 1.1sec 98% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 47.0 6.1 9.5sec 8.4sec 18% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.44%
σ of the average dps 4.1546
2 * σ / μ 0.0297%
95% Confidence Intervall ( μ ± 2σ ) ( 27997.48 - 28014.10 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27993.32 - 28018.25 )
Sample Data
σ 415.4575
Minimum 26477.31
Maximum 29742.22
Spread ( max - min ) 3264.90
Range ( max - min ) / 2 1632.45
Range% 5.83
10th Percentile 27500.24
90th Percentile 28554.51
( 90th Percentile - 10th Percentile ) 1054.26
Approx. Iterations needed for
1% dps error 8
0.1% dps error 880
0.1 scale factor error with delta=300 1534
0.05 scale factor error with delta=300 6137
0.01 scale factor error with delta=300 153426
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B bestial_wrath,if=focus>60
C multi_shot,if=target.adds>5
D cobra_shot,if=target.adds>5
E serpent_sting,if=!ticking
F kill_shot
G rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
H kill_command
I fervor,if=focus<=20
J focus_fire,five_stacks=1,if=!buff.beast_within.up
K arcane_shot,if=focus>=90|buff.beast_within.up
L cobra_shot

Sample Sequence

0134579BEHKKKKKHKKLLJKHLLKLKHLLKLKHLJLKLKHLLKLKHLLGKLJKHLLKLKHLLKLKHLJLKLKHLLKLKHLBKKKKHKKKKIHJLLKLKHLLLKLHLJKLKLHLLKLKHLLKJLKHLLK9LKHLLLKLHJLKLKLHLLKLBKHKKKKKHKKJLLLHLKLKLHLKLJKLHLLKLKHLLLKJLHLKLKLHLKLKLHJLLKLKHLLKLKHLBKKKKHKKKKIHJLLLKLHLKLLKHLJL9KKLHLLKLKHLLJLKKHLLLKLHLLKJLKHLLLKLHLKLBKKHKKKKKKHJLLKLLHLKLKLHLJKLKLHLLKKLHLKLJLKHLLKLKHLLKLJKHGLLLKKHLLKLKHBKKKKKHK9KKKJLHILLKLHLKLKLHJLLKLKHLLKLKHLJLLKKHLLKLKHLLJLKLHLLKLKHLLLBKKHKKKKKHKJLLFFHLLKLKHLLFFJKHLLKLKHLFFKLHJLLKLKFFHLLKLK9HJLF4FLKHLLKLKBFFHKKKKKHKJLFFKHLLLKLHFFLJKLHLLKLFFHLKLKJLHLKFFK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 8466 5817 5345
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 26125 14968 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.39% 29.23% 2305
Melee Haste 13.46% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.11% 6.87% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 2
One with Nature 3
Bestial Discipline 3
Pathfinding 0
Spirit Bond 2
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 3
Fervor 1
Focus Fire 1
Longevity 3
Killing Streak 2
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 1
Ferocious Inspiration 1
Kindred Spirits 2
The Beast Within 1
Invigoration 2
Beast Mastery 1
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 0
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_BM_T11_372
origin="http://chardev.org/?profile=34113"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
glyphs=bestial_wrath/kill_command/arcane_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/bestial_wrath,if=focus>60
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking
actions+=/kill_shot
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/fervor,if=focus<=20
actions+=/focus_fire,five_stacks=1,if=!buff.beast_within.up
actions+=/arcane_shot,if=focus>=90|buff.beast_within.up
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010122000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372 : 31620dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31619.8 15.91 / 0.05% 2787.4 11.3 11.2 focus 0.00% 59.9
Origin http://chardev.org/?profile=34117
Talents http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
Glyphs
  • steady_shot
  • aimed_shot
  • rapid_fire

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:35838|22340|20316|7407|4494|3316|1582&chds=0,71677&chco=336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++35838++chimera_shot,336600,0,0,15|t++22340++aimed_shot,C79C6E,1,0,15|t++20316++kill_shot,C79C6E,2,0,15|t++7407++steady_shot,C79C6E,3,0,15|t++4494++ranged,C79C6E,4,0,15|t++3316++claw,C79C6E,5,0,15|t++1582++melee,C79C6E,6,0,15&chtt=Hunter_MM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,18,13,9,8,7,7,5,5,3,1&chds=0,100&chco=C79C6E,C55D54,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=aimed_shot|piercing_shots|steady_shot|chimera_shot|ranged|aimed_shot_mm|wild_quiver_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7pYjxighjfsurillehiiffggacfjfcfhcdghfefhgfklhkmjlljlljkigdcdbbaaccbbbbcbaaabbaaaabaaaabbbbbbcccdeeeeeeedddeeeeeeeeeddeeeeeeeeedddeeedeeeddddeedddddddddddddeeddddeeeeeeeeeeffffeeeeeeefffggfffeeeeeeedddddddddddddddddddeedddYVXchjkkjihcYXadgijjihebZbehijhghhfcaaabdfhhgdbaabceghhfdbabcdfhihfdbbbcdfhihecbbcdegiihecbccdfhiigedccdegijigedddefhjjigedddeghjjhfedddegijihgfeefgjkkjhfeeeefhiihgfeeefgijjigfeefghjkjigffffhikkjhdZadjoqpmkifbbeimoonlifcbfknonljhg&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:00z004244434685443110zyzyxvvttssssrrrrrssssssssssssssssrrqqpponnmlkkjiihhggfffeeeeddddccccbbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbbaaaaaaZZZZZYYYYYYYYYYYZaaaabbccdefgghhhiijjkkllllllllkjjjiiihggfeedcccbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZZZZZZaaaaaaaaaaaabbbbbbccccddeeeeffffffggghhhhhhggffgggghggg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31620|max=62282&chxp=1,1,51,100&chtt=Hunter_MM_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,5,5,5,13,22,35,45,70,79,141,169,225,298,353,396,426,529,537,595,581,584,599,592,572,535,467,429,343,300,252,184,163,132,103,45,60,38,18,20,10,13,6,0,2,1,0,0,1&chds=0,599&chbh=5&chxt=x&chxl=0:|min=28820|avg=31620|max=34986&chxp=0,1,45,100&chtt=Hunter_MM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372 31620
aimed_shot 7620 24.1% 77.1 5.87sec 44686 22340 27696 59070 70452 54.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.13 76.98 0.00 0.00 2.0002 0.0000 3446629
Direct Results Count Pct Average Min Max Total Damage
hit 35.1 45.56% 27695.67 26825 34200 971290
crit 41.9 54.44% 59070.25 55260 70452 2475339

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2159 6.8% 23.4 18.79sec 41696 0 28032 58361 71552 45.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.42 23.38 0.00 0.00 0.0000 0.0000 976402
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 54.70% 28032.29 27244 34734 358446
crit 10.6 45.30% 58361.00 56123 71552 617955

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
chimera_shot 2885 9.1% 36.0 10.59sec 36290 35838 26236 54138 61279 36.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.95 35.86 0.00 0.00 1.0126 0.0000 1304707
Direct Results Count Pct Average Min Max Total Damage
hit 22.8 63.62% 26235.67 25522 29747 598422
crit 13.0 36.38% 54138.44 52576 61279 706285

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 398 1.3% 8.8 10.62sec 20543 20316 15057 31012 34397 36.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.77 8.66 0.00 0.00 1.0111 0.0000 180118
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.99% 15056.81 14794 16697 83416
crit 3.1 36.01% 31012.07 30476 34397 96702

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 5726 18.1% 160.7 2.80sec 16117 0 0 0 0 0.0% 0.0% 0.0% 0.0% 363 7135 0 0.0% 0.0% 80.3%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.68 160.68 362.98 362.98 0.0000 1.0000 2589732
Direct Results Count Pct Average Min Max Total Damage
hit 160.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 363.0 100.00% 7134.60 816 35127 2589732

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1412.85
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 2594 8.2% 146.8 3.09sec 7994 4494 5732 11862 13905 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.79 146.79 0.00 0.00 1.7785 0.0000 1173385
Direct Results Count Pct Average Min Max Total Damage
hit 92.6 63.11% 5732.30 5550 6750 531052
crit 54.2 36.89% 11862.03 11432 13905 642333

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.28 5.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 819 2.6% 1.4 102.77sec 262209 259824 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2418 3742 40.6% 0.0% 83.1%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.41 1.41 125.28 125.28 1.0092 3.0000 370397
Direct Results Count Pct Average Min Max Total Damage
hit 1.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 74.4 59.35% 2418.31 2353 2717 179818
crit 50.9 40.65% 3742.17 3635 4198 190578

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4068 12.9% 208.1 2.16sec 8842 7407 5919 12353 14446 45.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.12 207.74 0.00 0.00 1.1938 0.0000 1840167
Direct Results Count Pct Average Min Max Total Damage
hit 112.8 54.32% 5918.91 5786 7013 667856
crit 94.9 45.68% 12352.78 11919 14446 1172311

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2065 6.5% 122.0 3.69sec 7657 0 5586 11217 13159 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.96 121.96 0.00 0.00 0.0000 0.0000 933817
Direct Results Count Pct Average Min Max Total Damage
hit 77.1 63.22% 5585.92 5420 6580 430674
crit 44.9 36.78% 11216.62 10840 13159 503143

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3287
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1705 51.9% 151.3 3.00sec 5096 3316 3352 6765 10441 51.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.30 151.30 0.00 0.00 1.5370 0.0000 771072
Direct Results Count Pct Average Min Max Total Damage
hit 74.0 48.90% 3351.97 1767 5220 247994
crit 77.3 51.10% 6765.17 3535 10441 523078

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1582 48.1% 384.6 1.17sec 1860 1582 1275 2565 3174 51.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
384.55 384.55 0.00 0.00 1.1754 0.0000 715202
Direct Results Count Pct Average Min Max Total Damage
hit 95.3 24.79% 1274.77 1181 1587 121542
crit 196.9 51.19% 2565.20 2361 3174 505003
glance 92.3 24.01% 960.09 885 1190 88657

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372
aimed_shot focus 68.5% 980.9 46
chimera_shot focus 30.8% 824.8 44
serpent_sting focus 0.7% 10488.4 25
pet - cat
claw focus 100.0% 183.9 28
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.9 2353.4 1.3 2.8%
glyph_aimed_shot focus 52.6 260.1 4.9 1.0%
rapid_recuperation focus 312.4 339.2 1.1 6.0%
steady_shot focus 208.1 2133.1 10.2 0.2%
pet - cat focus
focus_regen focus 1809.9 3666.3 2.0 13.4%
go_for_the_throat focus 54.2 468.5 8.7 13.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.8 67.5 46.6sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.8sec 55.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.1 68.4 42.7sec 5.7sec 95% 95%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.2 95.0 18.7sec 3.8sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.5 0.0 18.8sec 18.8sec 5% 5%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.4sec 86.4sec 17% 18%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.6sec 222.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 57.7sec 57.7sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.8 67.5 46.6sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 237.3 45.0sec 1.8sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.1 6.5 9.7sec 8.5sec 16% 30%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 122.0 3.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.82%
σ of the average dps 7.9561
2 * σ / μ 0.0503%
95% Confidence Intervall ( μ ± 2σ ) ( 31603.88 - 31635.70 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31595.92 - 31643.66 )
Sample Data
σ 795.6134
Minimum 28820.21
Maximum 34985.79
Spread ( max - min ) 6165.58
Range ( max - min ) / 2 3082.79
Range% 9.75
10th Percentile 30630.07
90th Percentile 32665.81
( 90th Percentile - 10th Percentile ) 2035.74
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2532
0.1 scale factor error with delta=300 5626
0.05 scale factor error with delta=300 22506
0.01 scale factor error with delta=300 562667
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
M steady_shot

Sample Sequence

0134568AGHL6L6MIL6ML6ML6MIL6L6ML6MIML6KL6L6MIML6MML6MML6MMMGL6ML6MILL6ML6MIL6L6MML6MMLL6MMML6MML6MML6MMMLL6MIL6MEMIFLMML6MMMFMMML6MMMFKMML6MMMFMML6MMMKFMML6MMMMFKML6MIMMFML6MIMKMFMIL6MMMLL6AFMIML6MMMMMFL6MIMMKL6FMIML6MMMFMML6MGH5MFMMLL6L6MML6MFMGML6MML6ML6MFMILL6MMML6MFMIMLML6MIFML6MIMMMFKL6MIMMMFL6MIMMML6FMILMMML6FMIML6MMMFMMLL6MMMFMML6MMMMFKML6MIMML6FMMML6MAMMMFLML6MIMMMFML6MIMKMFL6MIMMML6FKL6MIMML6FMML6KMGHFL6MIL6L6MML6MFML6GMIL6JL6ML6FKL6MIJL6MMFL6MMJML6MFLMIJL6MMFL6MMJML6FMILL6JMIFMML6MJMIFL6MMMMJKL6FMIL6MJMIFML6MIJMKFL6MIM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8471 5822 5345
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.43% 12.43% 2229
Spell Haste 16.28% 10.75% 1376
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20914 11984 190
Melee Hit 8.04% 8.04% 966
Melee Crit 41.98% 28.82% 2229
Melee Haste 14.07% 10.75% 1376
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.12% 6.89% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 2
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 2
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372
origin="http://chardev.org/?profile=34117"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
glyphs=steady_shot/aimed_shot/rapid_fire
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2229
# gear_haste_rating=1376
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372_Arcane : 31029dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31028.8 13.53 / 0.04% 2910.7 10.7 10.5 focus 0.00% 59.1
Origin http://chardev.org/?profile=34115
Talents http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
Glyphs
  • steady_shot
  • rapid_fire
  • arcane_shot

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:36137|24661|20423|13049|7368|4314|3609|1689&chds=0,72274&chco=336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++36137++chimera_shot,336600,0,0,15|t++24661++aimed_shot,C79C6E,1,0,15|t++20423++kill_shot,C79C6E,2,0,15|t++13049++arcane_shot,69CCF0,3,0,15|t++7368++steady_shot,C79C6E,4,0,15|t++4314++ranged,C79C6E,5,0,15|t++3609++claw,C79C6E,6,0,15|t++1689++melee,C79C6E,7,0,15&chtt=Hunter_MM_T11_372_Arcane+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:15,14,13,11,9,8,7,6,6,5,3,1&chds=0,100&chco=C55D54,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,C79C6E&chl=piercing_shots|steady_shot|aimed_shot|ranged|chimera_shot|wild_quiver_shot|aimed_shot_mm|arcane_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372_Arcane+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7nSdranVjYfsjogeggffecfdZageYZegcabdfcabhigjlhijhhjjhjiccccbaYXYZYXWWXYXVVVWWWVUUVUUUUUUUUUUUUUUUVVUUVVUUTTUUUUUUUUTTTUUUUUUUUTTTUUUUUUUTTTUUUUUUUUTTTUUUUUUUTTTUUUVVVVVVUVVVVVVVVUVZccaWVWXXXTRSUUUTRQQRSTVWWVTSRRSTVWXWUSRUUSUbhihjihheYWXafihiihfcZZbehhdabbYUQOOPSVZbaWSPNOQTYbbZUQONPSWacbXTPNOQUYbcZVROOPSVZcbYTQOOQUYbcaWSPPQTXbdcZVRPPRUYbcbXTQPQSWacbZVRPPRUYbcddaZYWWZccZVUVUSQQQSUWYYXVTSSTVXZZZXUTSTVXZaaYWUTTUWYaaaaYWYcinpnkigcYZbfjlmljhebacfiklieba&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372_Arcane+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yz1y2033444577544321110z0xyvutsrsrrrrrrrrrrrrrrrrrrrrrrqqppponnmllkjiiihhggfffeeeedddddccccbbbbbaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZYYYYYYYYYYZaaaabbbcddegghhhiijjjkllmllllllkjjjiiihgffeddccbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZYYZZZZZZZZZZZZaaaaaaaaaaaaaaaaZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaabbbbbccdddeeeeefffggggggggggffgggghhhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31029|max=61424&chxp=1,1,51,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,1,4,9,7,20,31,53,72,104,138,178,216,274,366,384,451,477,565,612,670,653,614,594,595,488,422,390,354,243,235,204,143,114,94,53,36,38,38,31,10,7,2,0,3,1,1,0,0,2&chds=0,670&chbh=5&chxt=x&chxl=0:|min=28754|avg=31029|max=34038&chxp=0,1,43,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372_Arcane 31029
aimed_shot 4178 13.5% 36.9 11.55sec 51153 24661 28313 60370 70327 71.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.95 36.89 0.00 0.00 2.0742 0.0000 1889911
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 28.51% 28312.57 26771 34139 297752
crit 26.4 71.49% 60369.66 55149 70327 1592159

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2194 7.1% 23.6 18.69sec 41972 0 27988 58325 71426 46.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.64 23.60 0.00 0.00 0.0000 0.0000 992389
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 53.65% 27987.97 27189 34673 354370
crit 10.9 46.35% 58325.18 56010 71426 638019

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
arcane_shot 1989 6.4% 68.6 5.41sec 13115 13049 9470 19502 21283 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.59 68.42 0.00 0.00 1.0051 0.0000 899603
Direct Results Count Pct Average Min Max Total Damage
hit 43.3 63.33% 9469.60 9291 10332 410291
crit 25.1 36.67% 19502.27 19140 21283 489312

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
chimera_shot 2896 9.3% 36.0 10.55sec 36358 36137 26186 54025 61176 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.02 35.93 0.00 0.00 1.0061 0.0000 1309803
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.12% 26185.68 25473 29697 593828
crit 13.3 36.88% 54025.20 52474 61176 715974

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 404 1.3% 8.9 10.49sec 20572 20423 15036 30963 34332 36.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.89 8.77 0.00 0.00 1.0073 0.0000 182933
Direct Results Count Pct Average Min Max Total Damage
hit 5.6 63.49% 15035.97 14766 16666 83761
crit 3.2 36.51% 30963.33 30419 34332 99172

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 4763 15.3% 149.7 3.00sec 14392 0 0 0 0 0.0% 0.0% 0.0% 0.0% 358 6018 0 0.0% 0.0% 79.1%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
149.68 149.68 357.97 357.97 0.0000 1.0000 2154125
Direct Results Count Pct Average Min Max Total Damage
hit 149.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 358.0 100.00% 6017.63 815 33491 2154125

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1028.56
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 3552 11.4% 201.7 2.25sec 7964 4314 5704 11792 13885 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
201.72 201.72 0.00 0.00 1.8460 0.0000 1606500
Direct Results Count Pct Average Min Max Total Damage
hit 126.9 62.88% 5704.21 5541 6740 723587
crit 74.9 37.12% 11792.14 11414 13885 882913

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 818 2.6% 1.7 130.75sec 212906 211442 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2414 3735 41.1% 0.0% 83.0%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.74 1.74 125.10 125.10 1.0069 3.0000 369860
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.7 58.94% 2414.01 2349 2713 178011
crit 51.4 41.06% 3735.24 3629 4191 191848

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4189 13.5% 213.3 2.11sec 8884 7368 5913 12343 14426 46.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
213.28 212.89 0.00 0.00 1.2058 0.0000 1894718
Direct Results Count Pct Average Min Max Total Damage
hit 114.0 53.54% 5912.53 5777 7003 673939
crit 98.9 46.46% 12343.22 11901 14426 1220779

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2502 8.1% 148.0 3.04sec 7650 0 5570 11178 13141 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.96 147.96 0.00 0.00 0.0000 0.0000 1131826
Direct Results Count Pct Average Min Max Total Damage
hit 93.1 62.92% 5570.24 5412 6570 518550
crit 54.9 37.08% 11177.70 10823 13141 613277

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3544
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1856 52.4% 151.3 3.00sec 5547 3609 3643 7334 10421 51.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.30 151.30 0.00 0.00 1.5370 0.0000 839353
Direct Results Count Pct Average Min Max Total Damage
hit 73.2 48.40% 3642.98 1764 5211 266768
crit 78.1 51.60% 7333.70 3527 10421 572585

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1688 47.6% 410.2 1.10sec 1861 1689 1273 2561 3168 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
410.15 410.15 0.00 0.00 1.1021 0.0000 763380
Direct Results Count Pct Average Min Max Total Damage
hit 100.2 24.43% 1272.92 1178 1584 127526
crit 211.4 51.54% 2560.98 2356 3168 541367
glance 98.6 24.03% 958.50 884 1188 94487

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372_Arcane
aimed_shot focus 34.9% 1122.3 46
arcane_shot focus 31.3% 596.1 22
chimera_shot focus 32.9% 826.3 44
serpent_sting focus 0.9% 8516.2 25
pet - cat
claw focus 100.0% 201.9 27
Resource Gains Type Count focus Average Overflow
focus_regen focus 1809.9 2356.9 1.3 1.2%
rapid_recuperation focus 312.7 345.7 1.1 3.8%
steady_shot focus 213.3 2059.6 9.7 0.0%
pet - cat focus
focus_regen focus 1809.9 3476.2 1.9 16.7%
go_for_the_throat focus 74.9 632.3 8.4 15.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.6 68.4 47.5sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.0sec 55.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.5 68.9 41.1sec 5.6sec 96% 97%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.4 95.9 18.6sec 3.7sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.7 0.0 18.7sec 18.7sec 7% 7%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.1 0.0 80.0sec 80.0sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 17%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.2sec 222.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.1sec 55.1sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.6 68.4 47.5sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 248.8 45.0sec 1.7sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 55.9 6.6 8.1sec 7.2sec 20% 37%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 148.0 3.0sec

Statistics & Data Analysis

DPS
Population
Convergence 71.45%
σ of the average dps 6.7640
2 * σ / μ 0.0436%
95% Confidence Intervall ( μ ± 2σ ) ( 31015.27 - 31042.33 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31008.51 - 31049.09 )
Sample Data
σ 676.4049
Minimum 28753.55
Maximum 34038.37
Spread ( max - min ) 5284.82
Range ( max - min ) / 2 2642.41
Range% 8.52
10th Percentile 30188.95
90th Percentile 31929.55
( 90th Percentile - 10th Percentile ) 1740.60
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1900
0.1 scale factor error with delta=300 4066
0.05 scale factor error with delta=300 16267
0.01 scale factor error with delta=300 406687
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
M arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
N steady_shot

Sample Sequence

0134568AGHL6L6NIL6NL6NL6NIL6NL6LL6NIL6NL6NINL6NNLL6NNNL6NNGNLL6NL6NIL6NL6NILL6NNL6NNL6NNNL6KL6NIL6NNNL6NNNL6NNLENFNIMMNNNNFMKNMNINNFMKNMNINNFMNMNINKNFMMNINNMNFMKNINNMNFMNIMNKNNMFNMNINNMNAFNL6NINLL6NNFNMNMNINNFMKNMNINNFMNMNIGH5FNNLL6NL6NIL6NFNGNL6NNL6NL6KFL6NIL6NNNMFKMNINNNMFMNIMNNNKFMNIMNNNMFKNIMNNNMFNMNINNMNFMNIMNNNKFMNIMNNNMNFMKNINNMNFMNIMNNNMFKMNINNMNAFNNLL6NNL6NNENNFNMNKNINMFNMNINNMNFMNIMKNNNMFNMNINMGHFKNIL6L6NNL6NFNNGLL6NL6JNIFL6NNL6NL6JNIFNMNMNIJNFKMNINMJNFMNIMNKJMFNIMMNNNJMFNIMKNNJMFMNIMNNJNFKMMNINJMNFMNIMNJNMFNIMMANJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8449 5801 5325
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20860 11942 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.34% 29.18% 2305
Melee Haste 12.35% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.08% 6.84% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.96% 11.96% 710

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 1
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 1
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 2
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372_Arcane
origin="http://chardev.org/?profile=34115"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
glyphs=steady_shot/rapid_fire/arcane_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5325
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=710
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_SV_T11_372 : 26518dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26518.0 7.39 / 0.03% 2622.1 10.1 10.0 focus 0.00% 51.1
Origin http://chardev.org/?profile=34116
Talents http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
Glyphs
  • arcane_shot
  • explosive_shot
  • kill_shot

Charts

http://8.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:34056|31819|28198|17476|11636|4000|3849|1430|902&chds=0,68112&chco=C41F3B,9482C9,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++34056++explosive_shot,C41F3B,0,0,15|t++31819++black_arrow,9482C9,1,0,15|t++28198++kill_shot,C79C6E,2,0,15|t++17476++arcane_shot,69CCF0,3,0,15|t++11636++cobra_shot,336600,4,0,15|t++4000++claw,C79C6E,5,0,15|t++3849++ranged,C79C6E,6,0,15|t++1430++melee,C79C6E,7,0,15|t++902++wolverine_bite,C79C6E,8,0,15&chtt=Hunter_SV_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:28,23,14,7,7,6,5,5,4,1,0&chds=0,100&chco=336600,C41F3B,C79C6E,C79C6E,69CCF0,336600,C79C6E,9482C9,C79C6E,C79C6E,336600&chl=cobra_shot|explosive_shot|ranged|claw|arcane_shot|serpent_sting|melee|black_arrow|kill_shot|wolverine_bite|serpent_sting_burst&chtt=Hunter_SV_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yuXYn04mmz677ut2213upuwwyxiZYZgqnmsvvyyqswuvyruzzyzsjgggimnorsrsttuvutttstsplfbZabdhknqstuvwwvvuuuutqmieccdfhknpqrstuuuuttttsplhecbcdfhkmpqssttuutttsrpmifdccdfhkmoqstuuuuuuutsqoligffghjlnpqsttuuuuttsrpnkhfedefgjlnoqrsttttttssrpomlmmnpqrsttuuuutuuuutsqomkiggghjlmoprsttuuutttsqomjhgfffgiklnpqrstttttsrqonmllllmnprttuuvvvutttssrpnlihggghijlnpqrsstuuutsrpomkiggghhiklmopqrssstssrpnmkihggghhjkmnpqrrssssrrqomlkjklloqrtuvwwwwwvvutsqpnlkihggghiklmopqrrsssrqp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Hunter_SV_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:22333464444467765422zyxxwwvtuutstsrrrqrsrrqqpoonnnmmmmmmmnnnmnnnonnnnmmllllkkkkkkkkkkkkklllllkkkjjjjjjjijijjjjjjjjkkklkkkkkjkjjjjjjjjjjjjjjjkjjjjjiiiiihihiiiiiijjjjkkkkkkkkkkkkkjkjjkjkjkkkkkkkkkjjjjjiiiiiiiiiiiiiiijjjjjjjjjijijjjjjjjjkjkkkllllllllllklkkkkkkkkkkkkkkkkkkkkjjjjjjjjjijjjjjjjkkkkkklllllmmmmnnooppoppppppppooonnnmmllllllllmmmmmmnnnnnnnnnmmmmmmmmmmmnnnnonooonoonnnnnnnmmmmmmmmmmmnnnnnnnnnnnnnnonnoooooppppppppppppppooooooooooooopppppppqpqqpq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26518|max=40866&chxp=1,1,65,100&chtt=Hunter_SV_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,2,2,5,12,15,23,50,83,91,137,192,254,322,389,465,567,594,632,625,655,641,634,612,524,497,440,345,308,230,180,118,100,81,59,38,19,19,17,10,2,2,0,4,2,0,0,0,1&chds=0,655&chbh=5&chxt=x&chxl=0:|min=25172|avg=26518|max=28272&chxp=0,1,43,100&chtt=Hunter_SV_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_SV_T11_372 26518
arcane_shot 1781 6.7% 45.9 9.72sec 17571 17476 12470 25811 29416 38.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.85 45.78 0.00 0.00 1.0054 0.0000 805633
Direct Results Count Pct Average Min Max Total Damage
hit 28.2 61.58% 12469.91 12080 14280 351570
crit 17.6 38.42% 25811.49 24885 29416 454063

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 1299 4.9% 18.4 25.23sec 31992 31819 0 0 0 0.0% 0.0% 0.0% 0.0% 90 4611 9674 38.1% 0.0% 59.6%

Stats details: black_arrow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.36 18.32 89.80 89.80 1.0054 3.0000 587409
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 55.6 61.87% 4610.87 4458 5425 256168
crit 34.2 38.13% 9673.76 9317 11339 331241

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $o1 Shadow damage over $d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.095000
  • base_td:407.33
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
cobra_shot 7467 28.2% 210.3 2.14sec 16058 11636 10637 22110 25195 47.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.31 209.93 0.00 0.00 1.3800 0.0000 3377096
Direct Results Count Pct Average Min Max Total Damage
hit 110.2 52.49% 10636.61 10408 12231 1172139
crit 99.7 47.51% 22109.53 21440 25195 2204957

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
explosive_shot 6126 23.1% 80.9 5.61sec 34258 34056 0 0 0 0.0% 0.0% 0.0% 0.0% 240 7777 16319 44.3% 0.0% 35.2%

Stats details: explosive_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.88 80.71 239.71 239.71 1.0059 0.6633 2770672
Direct Results Count Pct Average Min Max Total Damage
hit 80.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.6 55.73% 7776.59 7501 9310 1038811
crit 106.1 44.27% 16318.53 15678 19458 1731861

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:Taking $w1 Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing $ Fire damage. The charge will blast the target every second for an additional $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.232000
  • base_td:353.32
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
kill_shot 952 3.6% 15.2 5.86sec 28358 28198 18192 37645 43151 54.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.18 15.00 0.00 0.00 1.0057 0.0000 430433
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 46.01% 18192.32 17321 20947 125562
crit 8.1 53.99% 37645.39 35682 43151 304871

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 3842 14.5% 207.4 2.19sec 8378 3849 5941 12291 14027 38.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.40 207.40 0.00 0.00 2.1765 0.0000 1737535
Direct Results Count Pct Average Min Max Total Damage
hit 127.8 61.63% 5941.42 5765 6809 759410
crit 79.6 38.37% 12290.61 11876 14027 978125

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1677 6.3% 1.0 0.00sec 758592 731671 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3137 6578 53.1% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 150.03 150.03 1.0368 3.0000 744846
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 70.3 46.88% 3136.94 3047 3676 220623
crit 79.7 53.12% 6577.58 6369 7682 524223

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
serpent_sting_burst 15 0.1% 1.0 0.00sec 6910 0 4834 9959 9959 40.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 6911
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 59.49% 4834.44 4834 4964 2876
crit 0.4 40.51% 9958.90 9959 9959 4034

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3903.54
  • base_dd_max:3903.54
pet - wind_serpent 3391
claw 1827 53.9% 134.4 3.36sec 6149 4000 4235 8520 12431 44.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.36 134.36 0.00 0.00 1.5370 0.0000 826112
Direct Results Count Pct Average Min Max Total Damage
hit 74.4 55.35% 4235.17 1978 6215 314933
crit 60.0 44.65% 8520.24 3955 12431 511179

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
lightning_breath 0 0.0% 15.5 30.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_breath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.47 15.47 0.00 0.00 1.4621 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.5 100.00% 0.00 0 0 0

Action details: lightning_breath

Static Values
  • id:24844
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases magic damage taken by $s2%.
  • description:Breathes lightning, increasing magic damage taken by $s2% for $d.
melee 1429 42.1% 322.0 1.40sec 2006 1430 1442 2900 3779 44.6% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
322.04 322.04 0.00 0.00 1.4032 0.0000 646055
Direct Results Count Pct Average Min Max Total Damage
hit 101.1 31.40% 1441.86 1321 1889 145813
crit 143.6 44.59% 2899.60 2643 3779 416372
glance 77.3 24.01% 1084.82 991 1417 83871

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
roar_of_recovery 0 0.0% 2.7 181.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_recovery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: roar_of_recovery

Static Values
  • id:53517
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1 focus every $t1 sec.
  • description:Your pet's inspiring roar restores $o1 focus over $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
wolverine_bite 135 4.0% 45.1 10.09sec 1352 902 933 1874 2471 44.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolverine_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.12 45.12 0.00 0.00 1.4992 0.0000 61017
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 55.39% 932.52 851 1236 23307
crit 20.1 44.61% 1873.70 1701 2471 37710

Action details: wolverine_bite

Static Values
  • id:53508
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A fierce attack causing $ damage, that your pet can use after it makes a critical attack. Cannot be dodged, blocked or parried.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1.00
  • base_dd_max:1.00

Resources

Resource Usage Type Res% DPR RPE
Hunter_SV_T11_372
arcane_shot focus 22.1% 798.7 22
black_arrow focus 14.0% 914.0 35
explosive_shot focus 63.4% 956.1 36
serpent_sting focus 0.5% 30343.7 25
pet - wind_serpent
claw focus 100.0% 222.4 28
Resource Gains Type Count focus Average Overflow
cobra_shot focus 210.3 1887.3 9.0 0.3%
focus_regen focus 1809.9 2245.1 1.2 0.6%
roar_of_recovery focus 8.2 80.9 9.9 0.8%
thrill_of_the_hunt focus 21.7 305.9 14.1 2.1%
pet - wind_serpent focus
focus_regen focus 1809.9 3020.6 1.7 15.9%
go_for_the_throat focus 79.6 650.2 8.2 18.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
culling_the_herd 18.3 41.7 24.9sec 7.5sec 82% 81%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.6sec 57.6sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
lock_and_load 7.5 0.0 56.4sec 56.4sec 5% 12%

Database details

  • id:56453
  • cooldown name:buff_lock_and_load
  • tooltip:Your next Arcane Shot or Explosive Shot spells trigger no cooldown and cost no focus.
  • max_stacks:2
  • duration:12.00
  • cooldown:22.00
  • default_chance:12.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.6sec 300.6sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.8sec 394.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 58.3sec 58.3sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
wind_serpent-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 6%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-culling_the_herd 18.3 41.7 24.9sec 7.5sec 82% 78%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-owls_focus 40.3 0.0 11.0sec 11.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_owls_focus
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:30.00%
wind_serpent-sic_em 17.1 0.5 25.4sec 24.6sec 7% 13%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-wolverine_bite 46.1 177.6 9.9sec 2.0sec 89% 100%

Database details

  • id:
  • cooldown name:buff_wolverine_bite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sniper_training

Database details

  • id:64420
  • cooldown name:buff_sniper_training
  • tooltip:Damage done by your Steady Shot and Cobra Shot increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:300.00%

Uptimes

%

Procs

Count Interval
lock_and_load 7.5 56.4sec
thrill_of_the_hunt 21.7 20.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.76%
σ of the average dps 3.6951
2 * σ / μ 0.0279%
95% Confidence Intervall ( μ ± 2σ ) ( 26510.62 - 26525.40 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26506.92 - 26529.09 )
Sample Data
σ 369.5118
Minimum 25171.77
Maximum 28271.53
Spread ( max - min ) 3099.76
Range ( max - min ) / 2 1549.88
Range% 5.84
10th Percentile 26067.41
90th Percentile 27006.06
( 90th Percentile - 10th Percentile ) 938.64
Approx. Iterations needed for
1% dps error 7
0.1% dps error 776
0.1 scale factor error with delta=300 1213
0.05 scale factor error with delta=300 4854
0.01 scale factor error with delta=300 121367
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B multi_shot,if=target.adds>2
C cobra_shot,if=target.adds>2
D serpent_sting,if=!ticking
E rapid_fire
F explosive_shot,non_consecutive=1
G black_arrow,if=!ticking
H kill_shot
I arcane_shot,if=focus>=70&buff.lock_and_load.down
J cobra_shot

Sample Sequence

0134579DEFGJJJIFJJIJIFJJIJIFJJJJIFJGJJJFJJFJFIFJIJIJFJJIGJFJJJIFJJJJFJJIJFJGJJFJJIJFJJJIFJFIFJJGJIFJJJJFJJIJFJ9JIJFJGJJFJJJJFJJJFJFIFJJGJFJJIJFJJJIFJJJJFJJGJJFJJJIJFJJIJFJJJIFJGJJFJJJJFJJJIFJJJIFJGJJFJJIJFJ9JIJFJJJIFJGJJJFJJJIFJJJIFJJJJFGJJJJFJJJIJFJJIJFJEJIGJJFJJJJIFJJJIJFJFIFJIJGJFJJJJFJJIJFJJJIFJGJJJFJ9JJJFJJIJFJJIJFJGJJFJJJIFJJJJFJJJIFJGJJFJFJFIFJJJIFJJJIFJJGJHHFJFJFJIJHHFJJIJFJGHHJFJJJIFJFHFHJIJIFJ9J4GHHJJFJJJJFHHJJIFJJJGFHHJJJFJJJFHFHFJIJIJFGHHJJF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 9526 6553 5367
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.07% 12.07% 2164
Spell Haste 16.68% 11.13% 1425
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 21332 13445 190
Melee Hit 8.04% 8.04% 966
Melee Crit 44.86% 30.71% 2164
Melee Haste 14.46% 11.13% 1425
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 14.07% 8.30% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.32% 11.32% 596

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 0
Bestial Discipline 1
Pathfinding 0
Spirit Bond 0
Frenzy 0
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 2
Survival Tactics 2
Trap Mastery 3
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 3
Counterattack 0
Lock and Load 2
Resourcefulness 3
Mirrored Blades 0
T.N.T. 2
Toxicology 2
Wyvern Sting 1
Noxious Stings 2
Hunting Party 1
Sniper Training 3
Serpent Spread 1
Black Arrow 1

Profile

#!./simc

hunter=Hunter_SV_T11_372
origin="http://chardev.org/?profile=34116"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
glyphs=arcane_shot/explosive_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking
actions+=/rapid_fire
actions+=/explosive_shot,non_consecutive=1
actions+=/black_arrow,if=!ticking
actions+=/kill_shot
actions+=/arcane_shot,if=focus>=70&buff.lock_and_load.down
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=5367
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2164
# gear_haste_rating=1425
# gear_mastery_rating=596
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=wind_serpent

Mage_Arcane_T11_372 : 28720dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28719.9 15.94 / 0.06% 13.7 2097.1 1889.8 mana 0.00% 217.0
Origin http://chardev.org/?profile=35357
Talents http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
Glyphs
  • evocation
  • arcane_power
  • slow
  • mirror_image
  • arcane_brilliance
  • conjuring
  • arcane_blast
  • arcane_missiles
  • mage_armor

Charts

http://7.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:41474|32295|17136|15227|1484&chds=0,82948&chco=C41F3B,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++41474++flame_orb,C41F3B,0,0,15|t++32295++arcane_blast,69CCF0,1,0,15|t++17136++arcane_barrage,69CCF0,2,0,15|t++15227++arcane_missiles,69CCF0,3,0,15|t++1484++mirror_arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:88,6,3,2,0,0&chds=0,100&chco=69CCF0,69CCF0,C41F3B,69CCF0,69CCF0,C41F3B&chl=arcane_blast|arcane_missiles|flame_orb_tick|mirror_arcane_blast|arcane_barrage|ignite&chtt=Mage_Arcane_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7876431zywvtrqonmlkihfecbZYWUTRQPOOORWcjqvyzzzzyyxxyyzzzzzyyxyyzz000zyyyzzz00zzyyyyzzz0zzyxwxxyyyyyxxxxxyyyyyyxxxyyyzzzz22221zyxwutsrqponmmlkjjihgfeedcbaZYYXWVUTTSRRQRRSVYbfkosvxz00111110000000zz00000000zz0000000zzzzz000000zzz0000000zzzz000000000000000000zzyxwvutrqponmlkjigfedcbaZYXXWVUTTSRRQQQRSUWadhlpsuwyz00111111100000zzzzzzyyyyyyyxxxxxxwwwwwvvvvvuuutttttssssrrrrrrrrrrrrrrsssssrrrqqpponmmlkjiihgffeddcbaaZYYXWVVUTTSSRRRRRSSTUUVWXYZacdefgghhiijjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=126652&chtt=Mage_Arcane_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:567777654332432zxvtsqonligdbZXVTSQQPOONNMLKKJJKLMNOOOPPPQQQRRRRSSSSSSSRRRRSSRRRRRRRRRRRRRQRRRRRRRRRRRQPQQQQQQQRRRSUWYabdefhijlmmmnnnnnnlkihgedbaZYXXWWWWVVVUUTTSRQPONMLKKJJIIIIIJJKKLMNOPQRSSTTUUVUUUUTTTSSSRRRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRSSTTUVVWXYZaabcccdeeeeeeeddccbaaZZYXXXWVTSRRQPONMLKKJJIIIIIIIJJKLLMNOPQQRRSSSSSSSSSSSSSRRRRRRRRRRRSSSSSSSSSSSTTTTTTTTUUUUUUVVVWWXXYYYZabcdeeffggghhhhgggffedccbaaZYYXXWVVVUUTTSSRRQQQPPPOOOOOOOOOOOOPPPPPPPPQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28720|max=79316&chxp=1,1,36,100&chtt=Mage_Arcane_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,1,7,12,18,35,33,64,108,130,175,261,338,337,402,461,531,540,579,616,582,615,528,512,520,404,385,343,309,233,191,152,151,115,95,72,44,35,18,13,7,12,5,4,2,2,0,0,1&chds=0,616&chbh=5&chxt=x&chxl=0:|min=26144|avg=28720|max=32131&chxp=0,1,43,100&chtt=Mage_Arcane_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Arcane_T11_372 28720
arcane_barrage 127 0.4% 2.7 86.74sec 21431 17136 16169 33216 39904 32.5% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.69 2.68 0.00 0.00 1.2506 0.0000 57562
Direct Results Count Pct Average Min Max Total Damage
hit 1.8 66.10% 16169.41 12601 19564 28654
crit 0.9 32.46% 33216.01 25894 39904 28908
miss 0.0 1.44% 0.00 0 0 0

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1915.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.803000
  • base_dd_min:1054.50
  • base_dd_max:1288.83
arcane_blast 25366 88.3% 261.4 1.73sec 43871 32295 33425 68823 136386 30.8% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.39 261.39 0.00 0.00 1.3585 0.0000 11467428
Direct Results Count Pct Average Min Max Total Damage
hit 177.3 67.82% 33424.64 17108 66363 5925531
crit 80.5 30.81% 68822.84 35256 136386 5541898
miss 3.6 1.37% 0.00 0 0 0

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:870.7
  • cooldown:0.00
  • base_execute_time:2.12
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $s1 Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1%, the casting time is reduced by ${$36032m3/-1000}.1 sec and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.057000
  • base_dd_min:1764.41
  • base_dd_max:2050.53
arcane_missiles 1632 5.7% 21.3 17.39sec 34668 15227 0 0 0 0.0% 0.0% 0.0% 0.0% 106 4962 10196 40.0% 1.4% 9.5%

Stats details: arcane_missiles

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.28 21.28 106.03 105.56 2.2768 0.4070 737719
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.8 58.58% 4962.22 3846 6123 306858
crit 42.3 40.03% 10195.58 7910 12535 430861
miss 1.5 1.39% 0.00 0 0 0

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches Arcane Missiles at the enemy, causing $7268s1 Arcane damage every $5143t2 sec for $5143d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.246000
  • base_dd_min:358.06
  • base_dd_max:358.06

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches $?[five]?[four][three] waves of Arcane Missiles at the enemy over $d, causing $7268s1 Arcane damage per wave. Each offensive spell you cast has a $79684h% chance to activate Arcane Missiles.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
arcane_power 0 0.0% 4.4 122.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.38 4.38 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.4 100.00% 0.00 0 0 0

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increased damage and mana cost for your spells.
  • description:When activated, you deal $s1% more spell damage but spells cost $s2% more mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
evocation 0 0.0% 3.4 131.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: evocation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.39 3.39 0.00 0.00 4.9020 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.4 100.00% 0.00 0 0 0

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1% of total mana every $t1 sec.
  • description:Gain $s1% of your mana instantly and another ${$m1*3}% of your total mana over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb 843 2.9% 7.7 61.19sec 49280 41474 0 0 0 0.0% 1.4% 0.0% 0.0% 114 0 0 0.0% 0.0% 25.3%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.74 7.74 114.15 0.00 1.1882 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.61% 0.00 0 0 0
miss 0.1 1.39% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_tick 843 2.9% 114.2 3.75sec 3339 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2535 5253 30.9% 1.4% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.15 0.00 0.00 114.15 0.0000 0.0000 381184
Tick Results Count Pct Average Min Max Total Damage
hit 77.3 67.73% 2534.72 1659 4229 195961
crit 35.3 30.89% 5253.13 3410 8690 185223
miss 1.6 1.39% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 107 0.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 50 970 0 0.0% 0.0% 22.1%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 32.00 49.97 49.97 0.0000 2.0000 48450
Direct Results Count Pct Average Min Max Total Damage
hit 32.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 50.0 100.00% 969.67 444 4972 48450

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1278.90
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
presence_of_mind 0 0.0% 5.5 91.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell.
pet - mirror_image_3 751
mirror_arcane_blast 751 100.0% 78.5 15.30sec 3711 1484 3606 5414 7616 9.8% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.48 78.48 0.00 0.00 2.5000 0.0000 291257
Direct Results Count Pct Average Min Max Total Damage
hit 69.2 88.17% 3606.44 2114 5078 249567
crit 7.7 9.81% 5413.59 3171 7616 41690
miss 1.6 2.02% 0.00 0 0 0

Action details: mirror_arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing ${($m1+$M1)/2} Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1% and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.275000
  • base_dd_min:224.56
  • base_dd_max:260.98

Resources

Resource Usage Type Res% DPR RPE
Mage_Arcane_T11_372
arcane_barrage mana 0.5% 13.4 1602
arcane_blast mana 96.6% 12.5 3502
conjure_mana_gem mana 1.3% 0.0 12706
flame_orb mana 0.6% 62.5 789
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 28778.6 15.9 2.5%
clearcasting none 24.8 18364.1 739.3 0.0%
evocation mana 13.6 236267.9 17425.4 0.2%
flask mana 1.0 4725.0 4725.0 0.0%
food mana 1.0 1417.5 1417.5 0.0%
initial_mana none 1.0 107548.4 107548.4 0.0%
mage_armor mana 1809.9 381274.3 210.7 2.5%
mana_gem mana 4.1 49807.7 12102.8 0.0%
master_of_elements mana 116.7 22110.5 189.5 0.7%
mp5_regen mana 1809.9 76869.6 42.5 2.4%
replenishment mana 1809.9 53096.1 29.3 2.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
arcane_blast 25.7 235.7 16.5sec 1.7sec 84% 98%

Database details

  • id:36032
  • cooldown name:buff_arcane_blast
  • tooltip:Arcane Blast damage increased by $w1%, casting time reduced by ${$m3/-1000}.1 sec and mana cost increased by $w2%.
  • max_stacks:4
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_missiles 22.2 98.7 18.7sec 3.7sec 71% 71%

Database details

  • id:79683
  • cooldown name:buff_arcane_missiles
  • tooltip:Arcane Missiles activated.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:40.00%
arcane_potency 28.6 1.8 16.1sec 15.1sec 19% 20%

Database details

  • id:
  • cooldown name:buff_arcane_potency
  • tooltip:(null)
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 4.4 0.0 122.1sec 122.1sec 14% 29%

Database details

  • id:12042
  • cooldown name:buff_arcane_power
  • tooltip:Increased damage and mana cost for your spells.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 179.8 81.3 2.5sec 1.7sec 81% 81%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 24.9 0.0 18.5sec 18.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
improved_mana_gem 4.1 0.0 127.3sec 127.3sec 13% 13%

Database details

  • id:
  • cooldown name:buff_improved_mana_gem
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.6 0.0 55.3sec 55.3sec 28% 28%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.4 0.0 50.4sec 50.4sec 25% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shard_of_woe 7.7 0.0 63.4sec 63.4sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shard_of_woe
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.4 0.0 114.5sec 114.5sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 120.6sec 120.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 75.8 189.3sec 5.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
focus_magic_feedback

Database details

  • id:
  • cooldown name:buff_focus_magic_feedback
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mage_armor

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
arcane_blast_0 9.8%
arcane_blast_1 9.4%
arcane_blast_2 9.2%
arcane_blast_3 9.0%
arcane_blast_4 62.5%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 4.1 127.3sec
munched_ignite 3.3 89.7sec
rolled_ignite 5.2 64.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.52%
σ of the average dps 7.9687
2 * σ / μ 0.0555%
95% Confidence Intervall ( μ ± 2σ ) ( 28703.94 - 28735.82 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28695.97 - 28743.78 )
Sample Data
σ 796.8747
Minimum 26144.16
Maximum 32130.73
Spread ( max - min ) 5986.57
Range ( max - min ) / 2 2993.28
Range% 10.42
10th Percentile 27760.88
90th Percentile 29815.37
( 90th Percentile - 10th Percentile ) 2054.49
Approx. Iterations needed for
1% dps error 30
0.1% dps error 3079
0.1 scale factor error with delta=300 5644
0.05 scale factor error with delta=300 22578
0.01 scale factor error with delta=300 564452
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 focus_magic
3 arcane_brilliance
4 mage_armor
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
A volcanic_potion,if=!in_combat
B volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
C arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
D mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
E mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
F flame_orb,if=target.time_to_die>=10
G presence_of_mind,arcane_blast
H arcane_blast,if=target.time_to_die<60&mana_pct>4
I arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
J evocation,invulnerable=1
K evocation,if=target.time_to_die>=31
L sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
M arcane_missiles
N arcane_barrage,if=buff.arcane_blast.stack>0
O arcane_barrage,moving=1
P fire_blast,moving=1
Q ice_lance,moving=1
R restart_sequence,name=conserve

Sample Sequence

0124A9CDEGFIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLLLLMRLLLLL9FMRLLLLLMRLLLLLMRLLLLGLMRLLLLLMRLLLLLMRLLLIBCDI9FIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLMEG9FMRLLLLLMRLLLLLMRLLLLLNMRLLLLLMRLLLLLMRLLLLLFMRLLII9CIID7IIIIIIIIIIIGIIIIIIIIIIIIIIIKFLLLMRL9LLLLMRLLLLLMRLLLLLNMRLLLLLMRLLLLLMRLFGLLLLMRLLLL9CEIDIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKFLMRLL9LLLNMRLLLLLNGMRLLLLLMRLLLLLMRLLLLHHHHHFHHHHHHHH9CDHHHHHHHHHHHHHHHHHHHHHHHHHHHHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 631 52 20
Agility 648 68 20
Stamina 7658 6035 5972
Intellect 6116 5416 4957
Spirit 291 291 101
Health 143995 121343 0
Mana 113691 103280 0
Spell Power 9145 7613 2207
Spell Hit 15.63% 15.63% 1601
Spell Crit 24.20% 15.12% 514
Spell Haste 20.14% 14.42% 1420
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 673 32 0
Melee Hit 13.33% 13.33% 1601
Melee Crit 14.56% 6.66% 514
Melee Haste 11.09% 11.09% 1420
Expertise 0.00 0.00 0
Armor 12578 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.05% 17.05% 1622

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 3
Invocation 2
Improved Arcane Missiles 2
Improved Blink 0
Arcane Flows 2
Presence of Mind 1
Missile Barrage 2
Prismatic Cloak 3
Improved Polymorph 0
Arcane Tactics 1
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 2
Slow 1
Nether Vortex 2
Focus Magic 1
Improved Mana Gem 2
Arcane Power 1
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 2
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Arcane_T11_372
origin="http://chardev.org/?profile=35357"
level=85
race=gnome
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
glyphs=evocation/arcane_power/slow/mirror_image/arcane_brilliance/conjuring/arcane_blast/arcane_missiles/mage_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/focus_magic
actions+=/arcane_brilliance
actions+=/mage_armor
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
actions+=/arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
actions+=/flame_orb,if=target.time_to_die>=10
actions+=/presence_of_mind,arcane_blast
actions+=/arcane_blast,if=target.time_to_die<60&mana_pct>4
actions+=/arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
actions+=/evocation,invulnerable=1
actions+=/evocation,if=target.time_to_die>=31
actions+=/sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
actions+=/arcane_missiles
actions+=/arcane_barrage,if=buff.arcane_blast.stack>0
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1
actions+=/restart_sequence,name=conserve
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist=soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5972
# gear_intellect=4957
# gear_spirit=101
# gear_spell_power=2207
# gear_hit_rating=1601
# gear_crit_rating=514
# gear_haste_rating=1420
# gear_mastery_rating=1622
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# trinket2=shard_of_woe,heroic=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_Frostfire_T11_372 : 24889dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24889.4 19.77 / 0.08% 27.0 921.2 791.3 mana 0.00% 39.0
Origin http://chardev.org/?profile=88851
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • frostfire
  • pyroblast
  • molten_armor

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56224|43977|39898|14270|9144|947&chds=0,112449&chco=C41F3B,C41F3B,C41F3B,2459FF,C41F3B,2459FF&chm=t++56224++flame_orb,C41F3B,0,0,15|t++43977++living_bomb,C41F3B,1,0,15|t++39898++pyroblast_hs,C41F3B,2,0,15|t++14270++frostfire_bolt,2459FF,3,0,15|t++9144++scorch,C41F3B,4,0,15|t++947++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:47,15,14,9,7,4,2,1,0,0,0,0&chds=0,100&chco=2459FF,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=frostfire_bolt|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8777766555543333222211110zzzyyyyxxxxwwvvuuuuuuutttttsrrrrrrrrrqqqpppooooonnnnmmllllllkkkkjjjiiiiiiihhhhggggffffffeeedddehjiiiiihhgggggfffffeeeddddddcccccbbbaaaaaaaZZZYYYYXXXXXXWWWVVUUUTTTTTSSRRRRQQQQQPPPPOOOONNNNNNMMMLLLLKKKKKKJJJIIIIIHHHHHJLMMMLLLLLLKKKJJJJIIIIIHHHHGGGGGFFFFFFFEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEFFFFFFGGGGGHHHHHHIIIIIIIIIJJJJJJJJJJJJJJJJJJJJKKKKKKLLLLLLMMMMMMNNNNNNNNNOOOOOOOOOOPPPPPPPQQQQQQQRRRRSSSSSSSTTTTTTTTTTUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116458&chtt=Mage_Fire_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:knqrttvwxyy12568764431zxwuusqonljihgfeeddddccbaaaaaaaabbbbaaaaaaaaabbbaZZZYYYYYYYYYXXWWWWWWWXXYYYYYYYYYZZaaaaZZZZZYZYYZZZYYYYYZZZabbccccccdddeefffffeedddddddddccbbaaaZZZZZZZYYYYYYZabcccddeeffgggghggffeedccbbaaZYYXXXXXXXXXXXXXXXXXXYYYZZZZZZZZZaaabbbbbccccccccccdccccccccccccccccccccccddddccccbbbbbbbaaaZZZYYZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbbbbbaaaaaaaZZZZZZYZZZaabbccdeefghhijjkkkkkkkjjjiihhggfeedddcccccbbbbbbbbbbbbbbccccddddeeeeeeefffffffeeedddddddddcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24889|max=51249&chxp=1,1,49,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,1,2,4,11,13,23,48,57,80,127,146,204,260,323,406,444,501,637,611,630,685,612,590,612,507,460,393,335,303,250,186,139,95,93,62,47,40,14,13,13,7,6,3,1,1,3&chds=0,685&chbh=5&chxt=x&chxl=0:|min=20960|avg=24889|max=28929&chxp=0,1,49,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_Frostfire_T11_372 24889
combustion 1653 6.6% 3.8 129.57sec 196055 171005 8194 16991 22952 31.4% 0.2% 0.0% 0.0% 53 9970 20785 31.7% 0.0% 8.5%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.81 3.81 52.65 52.65 1.1465 0.7273 747442
Direct Results Count Pct Average Min Max Total Damage
hit 2.6 68.46% 8193.83 7082 11170 21386
crit 1.2 31.38% 16991.20 14552 22952 20330
miss 0.0 0.15% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 35.9 68.26% 9970.15 3434 26082 358336
crit 16.7 31.74% 20785.35 7056 53595 347390

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10072.56
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.2 46.25sec 3075 0 2618 4048 4434 32.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.22 10.22 0.00 0.00 0.0000 0.0000 31427
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 67.70% 2618.02 2562 2870 18113
crit 3.3 32.18% 4047.91 3959 4434 13314
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
flame_orb 1073 4.3% 7.7 61.13sec 63250 56224 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.87 0.00 1.1250 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.18sec 7203 0 5466 11233 14777 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 0.00 0.00 0.0000 0.0000 55210
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.65% 5466.17 4925 7191 29181
crit 2.3 30.23% 11233.05 10121 14777 26029
miss 0.0 0.12% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 951 3.8% 114.9 3.70sec 3745 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2820 5833 30.8% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.87 0.00 0.00 114.87 0.0000 0.0000 430188
Tick Results Count Pct Average Min Max Total Damage
hit 79.3 69.06% 2820.14 2437 3893 223717
crit 35.4 30.81% 5833.32 5008 7999 206470
miss 0.1 0.12% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
frostfire_bolt 11591 46.6% 209.2 2.15sec 25058 14270 18536 38238 54480 30.6% 0.1% 0.0% 0.0% 194 490 1010 30.6% 0.0% 98.6%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
209.22 208.57 193.95 193.95 1.7559 2.2983 5242577
Direct Results Count Pct Average Min Max Total Damage
hit 144.6 69.32% 18536.22 16101 26513 2680093
crit 63.7 30.55% 38237.81 33086 54480 2436681
miss 0.3 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.7 69.43% 489.67 229 698 65942
crit 59.3 30.57% 1009.66 548 1435 59860

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:405.75
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
ignite 3741 15.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 214 7895 0 0.0% 0.0% 94.8%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 188.92 214.30 214.30 0.0000 2.0000 1691884
Direct Results Count Pct Average Min Max Total Damage
hit 188.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 214.3 100.00% 7894.99 161 53446 1691884

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2833.45
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4074 16.4% 35.9 12.80sec 51366 43977 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6552 13526 30.6% 0.0% 93.4%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.87 35.87 186.34 186.34 1.1680 2.2665 1619217
Direct Results Count Pct Average Min Max Total Damage
hit 35.8 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.2 69.35% 6551.87 5492 10800 846695
crit 57.1 30.65% 13526.37 11286 22191 772522

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 494 2.0% 35.8 12.65sec 6234 0 4724 9747 13716 30.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.82 35.82 0.00 0.00 0.0000 0.0000 223323
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 69.71% 4723.94 4154 6675 117966
crit 10.8 30.17% 9747.17 8536 13716 105357
miss 0.0 0.12% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2234 9.0% 21.7 20.19sec 46558 39898 21903 45193 64225 40.3% 0.1% 0.0% 0.0% 99 2358 4868 40.6% 0.0% 50.0%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.71 21.62 99.05 99.05 1.1669 2.2815 1010682
Direct Results Count Pct Average Min Max Total Damage
hit 12.9 59.53% 21902.58 19113 31256 281932
crit 8.7 40.33% 45193.22 39274 64225 394139
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 58.8 59.36% 2357.82 1985 3898 138634
crit 40.3 40.64% 4868.13 4079 8010 195977

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.1 5.08sec 11216 9144 8758 17965 23247 27.0% 0.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2265 0.0000 1681
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 72.78% 8757.54 7718 12010 955
crit 0.0 26.95% 17964.56 15859 23247 726
miss 0.0 0.27% 0.00 0 0 0

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 572
mirror_fire_blast 117 20.5% 34.3 33.52sec 1218 0 1172 1759 2116 9.8% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.29 34.29 0.00 0.00 0.0000 0.0000 41767
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.22% 1172.47 1105 1410 35867
crit 3.4 9.78% 1758.53 1658 2116 5899
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 455 79.5% 85.7 12.82sec 1894 947 2024 3037 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.72 77.15 0.00 0.00 2.0000 0.0000 162337
Direct Results Count Pct Average Min Max Total Damage
hit 68.8 89.15% 2024.25 1912 2421 139221
crit 7.6 9.87% 3036.54 2868 3631 23116
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_Frostfire_T11_372
flame_orb mana 1.8% 66.0 958
frostfire_bolt mana 73.9% 17.0 1472
living_bomb mana 23.3% 18.9 2712
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29495.6 16.3 0.0%
clearcasting none 25.1 39640.0 1577.1 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 621.7 112919.2 181.6 0.0%
mana_gem mana 3.0 36310.7 12103.6 0.0%
master_of_elements mana 110.0 40208.1 365.7 0.0%
mp5_regen mana 1809.9 78704.5 43.5 0.0%
replenishment mana 1809.9 54444.8 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 210.2 0.0 2.1sec 2.1sec 80% 80%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 21.8 1.0 20.2sec 19.2sec 9% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.2 0.0 52.0sec 52.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 34% 34%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 510.1sec 510.1sec 66% 66%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.4sec 47.4sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.2sec 115.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.9 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.8sec
munched_ignite 121.4 3.7sec
rolled_ignite 20.2 21.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.72%
σ of the average dps 9.8842
2 * σ / μ 0.0794%
95% Confidence Intervall ( μ ± 2σ ) ( 24869.67 - 24909.21 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24859.79 - 24919.09 )
Sample Data
σ 988.4227
Minimum 20959.87
Maximum 28928.51
Spread ( max - min ) 7968.65
Range ( max - min ) / 2 3984.32
Range% 16.01
10th Percentile 23681.04
90th Percentile 26202.28
( 90th Percentile - 10th Percentile ) 2521.24
Approx. Iterations needed for
1% dps error 63
0.1% dps error 6308
0.1 scale factor error with delta=300 8684
0.05 scale factor error with delta=300 34737
0.01 scale factor error with delta=300 868426
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I frostfire_bolt
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIIIIGFDIIIIIIIIFGIIIIIIIIFGIIIIIIFIIIIIHIFIIIIIIFGIIIIIGFIIIIIGIFGIIIIGIFIIBIGHIIFIIDIIIIFGIIIIIIFIIIIIIFIIGIIIIAEFIHIIIIIIFGIIIIIIFGIIIIIIFGIIIIIGFIIIBIIHIFIIIGIDIFIIIIIIFIIGIIIIFGIIIGIIFIIIGHIIIIJGFIIIIIIFIIIIIIFGIIIIIIFGIIIAEIIFGHIIIGIDFIIIIIIFIIIIIIFGIIIIIIFIIIIIIFHIIIIIIFIIIIIGIFIIIIIIFGIIIIIIFGIIIIHGFIIIDII9IFGIIIIIGFIIIIIG4FIIIIII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_Frostfire_T11_372
origin="http://chardev.org/?profile=88851"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/frostfire/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/frostfire_bolt
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_T11_372 : 26117dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26117.4 20.03 / 0.08% 28.7 911.3 779.7 mana 0.00% 39.2
Origin http://chardev.org/?profile=88793
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • fireball
  • pyroblast
  • molten_armor

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:56278|44039|39460|14482|9251|948&chds=0,112556&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF&chm=t++56278++flame_orb,C41F3B,0,0,15|t++44039++living_bomb,C41F3B,1,0,15|t++39460++pyroblast_hs,C41F3B,2,0,15|t++14482++fireball,C41F3B,3,0,15|t++9251++scorch,C41F3B,4,0,15|t++948++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:44,17,14,10,7,4,2,1,0,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=fireball|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77777666555433333222211110zzzyyyyxxxxwwvvvvvuuuuuuttsssssssrrrrrqqppppppoooonnmmmmmmlllllkkjjjjjjjjiiiihhhhhggggggffeeefjkkjjjjjiihhhhhhhggggfffeeeeeeeedddccccccbbbbbaaaZZZZZZYYYYXXWWWVVVVUUUTTTTSSSSSSRRRQQQQPPPPPPPOOONNNNNMMMMMLLLLKKKKKKJJLOPOOONNNNNNNMMMLLLLKKKKKKJJJJIIIIIHHHHHGGGGGFFFFFFFEEEEEEEDDDDDDDDDCCCCCCDDDDDDDDDDDDDDDEEEEEEEFFFFFGGGGGGGHHHHHHHIIIIIIIIIIIIIIIIIIIJJJJJKKKKKKLLLLLLMMMMMMMMNNNNNNNOOOOOOOOOPPPPPPPQQQQQRRRRRSSSSSSSTTTTTTTTTUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=116470&chtt=Mage_Fire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:jmnprstvwxy024677865310zxvusqpnljihgeeddddccbbaaZaZZZabbaaaaaaaZaaabbaaZZYYXXXXYYYXXWWWWVVVWWXXXXXXXYYYYZZaaZZZZZYYYYYYYZYYYYYZZaabbcccccdddeeefffffeeddddddddccbbaaaZZZZZZZYYYYYYYYZabbbccdddeefffffffeedcbbbaaZZYYXXXWWWWXXXXXXXXXXXXXYYYYZZZZZZZaaabbbcccccccdddddddddddddccccccccccccccccccccccbbbbbbbbaaZZZYYYYYYZZZZZZZZZZZZaaaaaaaaaaaaaabbbbbaaaaaaaaaZZZZZZZZZaaabbccddefgghiijjkkkkkkjjjjiihhggffeeedddccccbbbbbbbbbbbbbbbbbcccccdddddeeeeeeeddddddddddccc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26117|max=54322&chxp=1,1,48,100&chtt=Mage_Fire_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,3,4,15,15,22,49,71,78,109,148,188,256,317,366,419,524,562,551,600,626,645,611,580,497,438,392,361,305,264,214,190,149,106,106,67,41,41,19,10,14,6,7,5,1,2,1,1,1&chds=0,645&chbh=5&chxt=x&chxl=0:|min=22742|avg=26117|max=30391&chxp=0,1,44,100&chtt=Mage_Fire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_T11_372 26117
combustion 1795 6.9% 3.9 126.87sec 207387 180911 8213 17039 22952 31.4% 0.1% 0.0% 0.0% 54 10549 21995 31.9% 0.0% 8.7%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.91 3.91 54.15 54.15 1.1463 0.7252 811610
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 68.50% 8213.03 7082 11170 22018
crit 1.2 31.35% 17038.99 14552 22952 20905
miss 0.0 0.15% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 36.9 68.14% 10548.89 3628 26415 389249
crit 17.3 31.86% 21995.13 7455 54279 379438

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13958.27
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.2 46.58sec 3084 0 2617 4045 4434 32.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.15 10.15 0.00 0.00 0.0000 0.0000 31306
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.06% 2616.97 2562 2870 17818
crit 3.3 32.84% 4045.30 3959 4434 13489
miss 0.0 0.09% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
fireball 11601 44.4% 206.3 2.18sec 25431 14482 18530 38198 54499 35.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
206.31 205.55 0.00 0.00 1.7560 0.0000 5246509
Direct Results Count Pct Average Min Max Total Damage
hit 132.0 64.20% 18529.79 16106 26522 2445156
crit 73.3 35.68% 38198.20 33096 54499 2801353
miss 0.3 0.12% 0.00 0 0 0

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.124000
  • base_dd_min:898.89
  • base_dd_max:1146.36
flame_orb 1074 4.1% 7.7 61.16sec 63345 56278 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.83 0.00 1.1256 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing ${$82739m1} Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.22sec 7229 0 5473 11253 14777 30.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55399
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.37% 5472.69 4925 7191 29092
crit 2.3 30.51% 11253.02 10121 14777 26307
miss 0.0 0.12% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 952 3.6% 114.8 3.71sec 3749 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2819 5832 31.0% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.83 0.00 0.00 114.83 0.0000 0.0000 430501
Tick Results Count Pct Average Min Max Total Damage
hit 79.1 68.89% 2819.06 2437 3893 222988
crit 35.6 30.99% 5832.42 5008 7999 207513
miss 0.1 0.13% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 4396 16.8% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 208 9552 0 0.0% 0.0% 92.0%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 178.61 208.15 208.15 0.0000 2.0000 1988122
Direct Results Count Pct Average Min Max Total Damage
hit 178.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 208.1 100.00% 9551.57 745 52092 1988122

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:7490.13
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4068 15.6% 35.8 12.83sec 51428 44039 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6550 13519 30.8% 0.0% 93.2%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.77 35.77 185.94 185.94 1.1678 2.2657 1617298
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.6 69.19% 6550.50 5492 10800 842716
crit 57.3 30.81% 13519.23 11286 22191 774582

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 492 1.9% 35.7 12.68sec 6228 0 4717 9728 13716 30.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.73 35.73 0.00 0.00 0.0000 0.0000 222548
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 69.58% 4717.23 4154 6675 117282
crit 10.8 30.28% 9728.12 8536 13716 105266
miss 0.0 0.13% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2658 10.2% 26.1 16.87sec 46050 39460 21902 45100 64225 40.5% 0.1% 0.0% 0.0% 115 2355 4857 40.7% 0.0% 58.1%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.10 26.01 115.16 115.16 1.1670 2.2833 1202032
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 59.34% 21901.56 19113 31256 338011
crit 10.5 40.53% 45100.31 39274 64225 475434
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 68.3 59.27% 2355.12 1985 3898 160764
crit 46.9 40.73% 4857.36 4079 8010 227822

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 5.06sec 11317 9251 8831 18185 25702 26.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.15 0.15 0.00 0.00 1.2233 0.0000 1708
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 73.43% 8830.68 7718 12010 978
crit 0.0 26.57% 18185.27 15859 25702 729

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 573
mirror_fire_blast 117 20.5% 34.3 33.52sec 1221 0 1174 1761 2116 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.30 34.30 0.00 0.00 0.0000 0.0000 41870
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.12% 1174.40 1105 1480 35897
crit 3.4 9.89% 1761.09 1658 2116 5973
miss 0.3 0.99% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 456 79.5% 85.7 12.83sec 1897 948 2027 3042 3631 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.74 77.17 0.00 0.00 2.0000 0.0000 162652
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.04% 2027.45 1912 2537 139308
crit 7.7 9.95% 3041.67 2868 3631 23344
miss 0.8 1.01% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_T11_372
fireball mana 73.6% 17.3 1471
flame_orb mana 1.8% 66.1 958
living_bomb mana 23.6% 18.9 2717
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29491.5 16.3 0.0%
clearcasting none 25.1 39543.0 1574.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 566.6 103105.5 182.0 0.0%
mana_gem mana 3.0 36311.8 12103.9 0.0%
master_of_elements mana 119.8 44779.2 373.7 0.0%
mp5_regen mana 1809.9 78694.3 43.5 0.0%
replenishment mana 1809.9 54396.2 30.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 207.3 0.0 2.2sec 2.2sec 79% 79%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 26.2 1.4 16.9sec 16.0sec 11% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 31% 31%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 519.5sec 519.5sec 69% 69%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 48.1sec 48.1sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.2sec 115.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.5sec 414.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.9 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.8sec
munched_ignite 93.7 4.8sec
rolled_ignite 16.6 26.0sec

Statistics & Data Analysis

DPS
Population
Convergence 69.94%
σ of the average dps 10.0165
2 * σ / μ 0.0767%
95% Confidence Intervall ( μ ± 2σ ) ( 26097.32 - 26137.38 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26087.30 - 26147.40 )
Sample Data
σ 1001.6539
Minimum 22742.24
Maximum 30390.76
Spread ( max - min ) 7648.52
Range ( max - min ) / 2 3824.26
Range% 14.64
10th Percentile 24903.29
90th Percentile 27474.51
( 90th Percentile - 10th Percentile ) 2571.22
Approx. Iterations needed for
1% dps error 58
0.1% dps error 5883
0.1 scale factor error with delta=300 8918
0.05 scale factor error with delta=300 35673
0.01 scale factor error with delta=300 891831
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I fireball
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138ABFEHIIIIGIDIFGIIIIGIIIFGIIIIIIIIFIIIIIIIFIIIIIHIFIIIIIIFIIIIIIFIIIIIIFIIIIIIFGIIIBIHIFIIIGIDIFIIIIIGIFIIIIIIFIIIIIIFIIAEIHIIIFIIIIIGIFGIIIIIGFIIIIGIIFIIIGIIIBFIHIIIIIFIIIIIIFIIIGIDIIJIFGIIIIIIFGIIIHIIFGIIIIIIFGIIGIIIFIIIIIIFIIIIIIFAEGIIHIIIIFGIIIIIIFIIIIIGIFDIIIIIIFGIIIIIIFHIIIIIIFGIIGIIIFGIIIGIIFIIIIGIIFIIIIGHIFIIII4GI9FIIIIIGIFIIDIIIGFIIIGII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_T11_372
origin="http://chardev.org/?profile=88793"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/fireball/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/fireball
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_Frostfire_T11_372 : 25115dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25114.8 11.51 / 0.05% 27.9 901.4 760.8 mana 0.01% 42.9
Origin http://chardev.org/?profile=87205
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • ice_lance
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:78595|34944|31099|19964|13721|2435|989&chds=0,157190&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++78595++deep_freeze,2459FF,0,0,15|t++34944++frostfire_orb,2459FF,1,0,15|t++31099++ice_lance,2459FF,2,0,15|t++19964++frostbolt,2459FF,3,0,15|t++13721++frostfire_bolt,2459FF,4,0,15|t++2435++water_bolt,2459FF,5,0,15|t++989++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:37,23,13,10,7,5,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostfire_bolt|ice_lance|deep_freeze|water_bolt|ignite|frostbolt|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77766665555544444332111100000zzzyyyxxxwwwvvvuuuutttssssrrrrrqqqqppppooonnnnnmmmmmllllkkkkkkjjjjjjiiiihhhhhggggggggffffegjkkkjjjjjiiiiihhhhhhgggggggfffffeeeeeedddddcccccbbbbbbaaaaaaZZYYYYYXXXXXXXWWWWWWVVVVVVUUUUUTTTSSSSRRRRQQQQQPPPPOOONNNNNNPRSSSSRRRRRRQQQQQQPPPPPPPOOOOOONNNNNNNNMMMMMMLLLLLLLLLLLKKKKKKKKKKKKJJJJJJJJJJJJJJJJJKKKKKKKLLLLLLLMMMMMMNNNNNNNNNNOOOOOOOOOOOOOOOOPPPPPPQQQQRRRRSSSSSTTTTTUUUUUUUVVVVVVWWWWWWWWWXXXXXXXXYYYYYYYZZZZZaaaaaaaaabbbaa&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118830&chtt=Mage_Frost_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:34466777654768033210ywvxxvtrqqponnmnlllklmoplklllmmmmortuvvvvvvuttuuvvxxxxvtrqppponmmkklllkjjjjjjjkklklklkkkjihhggffeeeeffgghijkklllllmlmmmlkkjjjihhgghhhhiijjjjjjiiiihhhgfeeddccbccdfgijklmooqqssssssrrqpnmlkjjiiihihiijkjkkllllllllllkkkkkjkjjjkklmmnnonnnnnmmlllllkkjjhhgfffffffgghhhihihihiiijjjjiihgffeeeeeeffgghghhiiijjkjkkkkkkjjiihggggfggggggghhhhhhhhhihhhggggggghhijkmnoprrttuuuuuuttsrqonlkihfeedddddeeeeeffgfggghhhhhgggggghhiijkkllmmnnnnnnopppppppoon&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25115|max=40158&chxp=1,1,63,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,2,3,5,12,14,19,31,36,51,72,118,130,180,220,280,355,403,442,491,554,561,584,593,570,579,571,547,442,418,340,287,248,182,183,140,100,66,49,36,22,21,18,6,7,2,3,1,3&chds=0,593&chbh=5&chxt=x&chxl=0:|min=22983|avg=25115|max=27313&chxp=0,1,49,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_Frostfire_T11_372 25115
cold_snap 0 0.0% 1.5 386.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.49 1.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 46.80sec 3079 0 2609 4036 4434 33.8% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31130
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 65.73% 2609.37 2562 2870 17342
crit 3.4 33.79% 4035.97 3959 4434 13788
miss 0.0 0.48% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3289 13.1% 16.1 28.78sec 92495 78595 42794 94310 151697 96.9% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.08 16.08 0.00 0.00 1.1769 0.0000 1487181
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 2.55% 42794.28 39611 63277 17558
crit 15.6 96.92% 94309.93 81395 151697 1469622
miss 0.1 0.53% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 1227 4.9% 27.6 16.51sec 20085 19964 15068 31208 41335 31.9% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.62 27.54 0.00 0.00 1.0061 0.0000 554773
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 67.56% 15068.05 13668 20116 280314
crit 8.8 31.94% 31208.06 28086 41335 274459
miss 0.1 0.50% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 9280 37.0% 175.8 2.54sec 23869 13721 17157 35985 70339 33.0% 0.5% 0.0% 0.0% 192 459 948 32.6% 0.0% 97.8%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.83 175.25 191.91 191.91 1.7395 2.3047 4196780
Direct Results Count Pct Average Min Max Total Damage
hit 116.6 66.52% 17156.62 15631 29432 2000016
crit 57.7 32.95% 35984.80 32119 70339 2077996
miss 0.9 0.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.3 67.35% 459.17 184 784 59353
crit 62.7 32.65% 948.35 377 1612 59415

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:376.40
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 835 3.3% 9.0 51.53sec 42003 34944 0 0 0 0.0% 0.6% 0.0% 0.0% 123 0 0 0.0% 0.0% 27.1%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.99 8.99 122.55 0.00 1.2020 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.44% 0.00 0 0 0
miss 0.1 0.56% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 835 3.3% 122.5 3.50sec 3081 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2295 4769 32.2% 0.5% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.55 0.00 0.00 122.55 0.0000 0.0000 377567
Tick Results Count Pct Average Min Max Total Damage
hit 82.4 67.23% 2295.50 2057 2934 189119
crit 39.5 32.25% 4768.54 4228 6029 188448
miss 0.6 0.52% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 5764 23.0% 71.9 6.29sec 36250 31099 0 36515 57773 99.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
71.91 71.77 0.00 0.00 1.1656 0.0000 2606651
Direct Results Count Pct Average Min Max Total Damage
crit 71.4 99.47% 36514.73 31440 57773 2606651
miss 0.4 0.53% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1724 6.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 186 4196 0 0.0% 0.0% 82.2%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 131.78 185.82 185.82 0.0000 2.0000 779610
Direct Results Count Pct Average Min Max Total Damage
hit 131.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 185.8 100.00% 4195.59 56 21513 779610

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3268.13
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 596
mirror_fire_blast 122 20.5% 34.2 33.51sec 1274 0 1226 1838 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.21 34.21 0.00 0.00 0.0000 0.0000 43599
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.15% 1226.24 1105 1625 37400
crit 3.4 9.85% 1838.48 1657 2437 6198
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 474 79.5% 85.5 12.82sec 1977 989 2114 3170 4167 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.53 76.98 0.00 0.00 2.0000 0.0000 169119
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.09% 2113.92 1912 2778 144970
crit 7.6 9.90% 3169.74 2867 4167 24149
miss 0.8 1.01% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2461
freeze 27 1.1% 17.0 27.43sec 714 0 540 1078 1136 33.3% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12133
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 65.71% 539.83 529 588 6030
crit 5.7 33.29% 1078.46 1055 1136 6103
miss 0.2 1.00% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2434 98.9% 205.7 2.19sec 5344 2435 4045 8135 10724 33.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.70 204.59 0.00 0.00 2.1949 0.0000 1099253
Direct Results Count Pct Average Min Max Total Damage
hit 134.1 65.56% 4045.11 3682 5376 542575
crit 68.4 33.45% 8134.94 7346 10724 556678
miss 2.0 0.99% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_Frostfire_T11_372
deep_freeze mana 6.2% 59.0 1567
frostbolt mana 13.8% 9.9 2037
frostfire_bolt mana 59.4% 17.3 1377
frostfire_orb mana 2.1% 44.7 940
ice_lance mana 16.6% 38.6 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29462.3 16.3 0.1%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 461.8 82104.6 177.8 0.0%
mana_gem mana 3.0 36306.6 12102.2 0.0%
master_of_elements mana 153.9 57396.0 373.1 0.0%
mp5_regen mana 1809.9 78617.1 43.4 0.1%
replenishment mana 1809.9 54312.2 30.0 0.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.5sec 187.5sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 4.1 0.0 82.7sec 82.7sec 0% 2%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 200.1 0.0 2.2sec 2.2sec 70% 70%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 33.6 48.2 13.6sec 5.5sec 77% 98%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.0sec 104.0sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.0 0.0 246.1sec 246.1sec 25% 26%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.3 0.0 427.3sec 427.3sec 75% 75%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 114.2sec 114.2sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 65.2sec 65.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.8sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 27.7 16.5sec
mana_gem 3.0 120.8sec
munched_ignite 32.2 13.5sec
rolled_ignite 10.5 38.2sec

Statistics & Data Analysis

DPS
Population
Convergence 71.22%
σ of the average dps 5.7527
2 * σ / μ 0.0458%
95% Confidence Intervall ( μ ± 2σ ) ( 25103.34 - 25126.35 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25097.58 - 25132.10 )
Sample Data
σ 575.2714
Minimum 22983.27
Maximum 27312.67
Spread ( max - min ) 4329.41
Range ( max - min ) / 2 2164.70
Range% 8.62
10th Percentile 24400.05
90th Percentile 25866.26
( 90th Percentile - 10th Percentile ) 1466.21
Approx. Iterations needed for
1% dps error 20
0.1% dps error 2098
0.1 scale factor error with delta=300 2941
0.05 scale factor error with delta=300 11766
0.01 scale factor error with delta=300 294166
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*15)<target.time_to_die
M frostbolt,if=!cooldown.early_frost.remains
N frostfire_bolt
O ice_lance,moving=1
P fire_blast,moving=1

Sample Sequence

01359BJDEHMNNNJNNJNNJNJMNNJKKNJNJNHNMNNFGJNNNJJNNNJKMJNJNNDNHCDGNAHMNNNNNKKKKNJMNNNNJNNHNMNNNKNJNNNMNBNNNDNNNNHKKMJNNNNNJNJMNNNNKNHNNJMNNNNENNDNJJJKMJHNNNJNNNGMNJNNNJKNJNJMHNNFNNNNNNBNMNKDNJNJNNHJMJINNNNJKNJMNNNJNNHLNMNNNJKNJNDMNJNJNNHNJMNKNJNNNNNMNNNNNHNNGKJJMNENNNNDNNNMNJNNHKJNNMNJNNJNNNNMKKNFJHNNNNNJMNJNDNNN4JJKMKNHNNCDGHNNJJMNJNNNNNKNJMJNNNJHNNNMNNNNNJNNMNJNDJHNJNJJJJJKMJNJNNNNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.47% 16.47% 1687
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.05% 14.05% 1687
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.43% 7.43% 973

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_Frostfire_T11_372
origin="http://chardev.org/?profile=87205"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/ice_lance/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*15) actions+=/frostbolt,if=!cooldown.early_frost.remains
actions+=/frostfire_bolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1687
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=973
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_T11_372 : 26027dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26027.1 10.49 / 0.04% 20.8 1254.3 1098.3 mana 0.02% 48.7
Origin http://chardev.org/?profile=87885
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • frostbolt
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:77868|39022|35359|29597|15183|2414|990&chds=0,155737&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++77868++deep_freeze,2459FF,0,0,15|t++39022++frostfire_bolt,2459FF,1,0,15|t++35359++frostfire_orb,2459FF,2,0,15|t++29597++ice_lance,2459FF,3,0,15|t++15183++frostbolt,2459FF,4,0,15|t++2414++water_bolt,2459FF,5,0,15|t++990++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:41,18,12,10,9,4,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostbolt|ice_lance|deep_freeze|frostfire_bolt|water_bolt|ignite|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776655544433222110zzzyyxxwwwwvvuttssrrqqpoonnmmllkkjjjjiihhggggffeeeddcccbbbaaaZZZYYXXXWWWVVVUUUTTTTSSSSSSSSSSSRRRRRRRSWWWWWWWWWWWVVVVVVVVVVVVVVVVVVVVVVVVWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVVWWWWWWWWXXXXXXXXXXXXXXXXXWWWWWWWWWWWWVVVVVVVVUUUUUUXaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZYYYYYYYYYYYXXXXXXXXXXXWWWWWWWWWVVVVVVVVVVVUUUUUUUUUUUUUUUUUUUUUUTTTTTTTTTTTTTSSSSSRRRRRQQQQQQQPPPPPPPPPQQQQQQQQPPPPPPPPPPPPOOOOOOOOOOONNNNNNMMMMMMMMMMMMMMMMMMMMMMMMMNNNNMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=118830&chtt=Mage_Frost_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13355676654768133210yxvxwusrppoommmnlmlllmoolklllmmnmoqrststtutssstuuuvvvwussrqpponmmllkkkjiiiiiiijjjjjjjjjjiihhggfffeedeeffghhiijjkkkkkkklkkkjjiihggggggghhhhihhhhhggggfffeedcbbbbbcdeggijklmnoppppqqppoonmlkjiihhgggghhiijjjjjkkkkkkkkkkkkkkjkjjkkkkllmllmllkkkkjjjjjiihhggfffefefffffgggggghhhihihihhgggffffeeffffffggghhiijjjjjkjkjjiiihhhhghgggggggghghhhhhhhhhhgggghhhiijklmnnppqqrsssssrrqppnnlkjigffeeeedddddeeefefffggggggggggghhiijjjkkllllmllmmnnnnnnnmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26027|max=42488&chxp=1,1,61,100&chtt=Mage_Frost_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,0,3,0,1,13,18,26,48,69,87,132,189,218,299,336,433,490,505,611,646,632,651,712,614,575,530,464,387,302,258,186,149,121,92,67,46,29,16,20,5,8,3,1,4,0,3&chds=0,712&chbh=5&chxt=x&chxl=0:|min=23822|avg=26027|max=28194&chxp=0,1,50,100&chtt=Mage_Frost_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_T11_372 26027
cold_snap 0 0.0% 1.5 389.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.46 1.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 69 0.3% 10.1 47.03sec 3081 0 2610 4039 4434 33.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.06 10.06 0.00 0.00 0.0000 0.0000 30997
Direct Results Count Pct Average Min Max Total Damage
hit 6.7 66.93% 2610.26 2562 2870 17578
crit 3.3 33.02% 4039.09 3959 4434 13419
miss 0.0 0.05% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3216 12.4% 15.9 29.15sec 91495 77868 43158 94147 151188 94.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.89 15.89 0.00 0.00 1.1750 0.0000 1454120
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 5.11% 43158.17 39444 63065 35075
crit 15.1 94.84% 94146.75 81052 151188 1419046
miss 0.0 0.05% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 10543 40.5% 230.6 1.94sec 20671 15183 14995 31077 41335 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
230.63 229.88 0.00 0.00 1.3614 0.0000 4767424
Direct Results Count Pct Average Min Max Total Damage
hit 147.6 64.20% 14995.36 13668 20116 2212933
crit 82.2 35.76% 31076.73 28086 41335 2554491
miss 0.1 0.05% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.857000
  • base_dd_min:662.43
  • base_dd_max:844.80
frostfire_bolt 2732 10.5% 27.2 16.21sec 45434 39022 20130 44067 70103 94.6% 0.0% 0.0% 0.0% 121 360 740 71.4% 0.0% 61.2%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.20 27.11 121.19 121.19 1.1643 2.2831 1235624
Direct Results Count Pct Average Min Max Total Damage
hit 1.5 5.39% 20129.64 18456 29333 29395
crit 25.6 94.57% 44067.23 37924 70103 1129707
miss 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 34.6 28.56% 360.24 205 869 12469
crit 86.6 71.44% 739.79 421 1786 64052

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w3 Frostfire damage per $t3 sec. Movement slowed by $w1%.
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m1+$m2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:173.64
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 841 3.2% 9.0 51.76sec 42489 35359 0 0 0 0.0% 0.0% 0.0% 0.0% 124 0 0 0.0% 0.0% 27.4%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.95 8.95 123.78 0.00 1.2017 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.96% 0.00 0 0 0
miss 0.0 0.04% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing ${$84721m1} Frost damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 841 3.2% 123.8 3.47sec 3073 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2295 4782 31.3% 0.0% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.78 0.00 0.00 123.78 0.0000 0.0000 380415
Tick Results Count Pct Average Min Max Total Damage
hit 84.9 68.63% 2295.46 2057 2934 194991
crit 38.8 31.33% 4781.89 4228 6029 185423
miss 0.1 0.05% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 4676 18.0% 61.2 7.38sec 34555 29597 0 34643 54837 99.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.19 61.06 0.00 0.00 1.1675 0.0000 2114346
Direct Results Count Pct Average Min Max Total Damage
crit 61.0 99.95% 34642.79 29816 54837 2114346
miss 0.0 0.05% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1042 4.0% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 169 2790 0 0.0% 0.0% 74.7%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 127.89 168.98 168.98 0.0000 2.0000 471419
Direct Results Count Pct Average Min Max Total Damage
hit 127.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 169.0 100.00% 2789.74 56 21598 471419

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:652.05
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 598
mirror_fire_blast 122 20.5% 34.2 33.50sec 1277 0 1228 1843 2437 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.23 34.23 0.00 0.00 0.0000 0.0000 43702
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.14% 1227.69 1105 1625 37463
crit 3.4 9.89% 1842.98 1657 2437 6239
miss 0.3 0.97% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 475 79.5% 85.6 12.81sec 1981 990 2116 3176 4167 10.0% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.58 77.02 0.00 0.00 2.0000 0.0000 169526
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.05% 2116.48 1912 2778 145173
crit 7.7 9.96% 3175.68 2867 4167 24352
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2440
freeze 27 1.1% 17.0 27.43sec 707 0 540 1078 1172 32.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12018
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 66.90% 539.62 529 588 6138
crit 5.5 32.08% 1078.21 1055 1172 5880
miss 0.2 1.02% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2413 98.9% 205.7 2.19sec 5299 2414 4043 8139 10724 32.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.70 204.59 0.00 0.00 2.1949 0.0000 1090109
Direct Results Count Pct Average Min Max Total Damage
hit 136.3 66.62% 4042.66 3682 5376 550999
crit 66.2 32.38% 8138.68 7346 10724 539110
miss 2.1 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_T11_372
deep_freeze mana 4.4% 58.4 1567
frostbolt mana 82.8% 10.1 2037
frostfire_orb mana 1.5% 45.2 940
ice_lance mana 10.1% 36.8 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29504.4 16.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 1162.0 206270.9 177.5 0.0%
mana_gem mana 3.0 36303.6 12101.2 0.0%
master_of_elements mana 184.4 85630.2 464.4 0.0%
mp5_regen mana 1809.9 78727.2 43.5 0.0%
replenishment mana 1809.9 54357.1 30.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.7 0.0 187.3sec 187.3sec 6% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 27.5 7.0 16.1sec 12.8sec 18% 100%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 231.3 0.0 1.9sec 1.9sec 66% 66%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 46.6 46.6 9.8sec 4.9sec 66% 89%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.4sec 104.4sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.9 0.0 53.2sec 53.2sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
mage_armor 1.5 0.0 249.1sec 249.1sec 64% 64%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.5 0.0 278.3sec 278.3sec 36% 38%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.9sec 48.9sec 25% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 112.4sec 112.4sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 64.9sec 64.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.7 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 28.2 16.2sec
mana_gem 3.0 120.7sec
munched_ignite 26.3 16.0sec
rolled_ignite 11.6 34.8sec

Statistics & Data Analysis

DPS
Population
Convergence 71.07%
σ of the average dps 5.2448
2 * σ / μ 0.0403%
95% Confidence Intervall ( μ ± 2σ ) ( 26016.63 - 26037.61 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26011.39 - 26042.86 )
Sample Data
σ 524.4767
Minimum 23821.86
Maximum 28193.80
Spread ( max - min ) 4371.94
Range ( max - min ) / 2 2185.97
Range% 8.40
10th Percentile 25367.30
90th Percentile 26708.97
( 90th Percentile - 10th Percentile ) 1341.68
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1624
0.1 scale factor error with delta=300 2445
0.05 scale factor error with delta=300 9780
0.01 scale factor error with delta=300 244511
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*12)<target.time_to_die
M frostbolt
N ice_lance,moving=1
O fire_blast,moving=1

Sample Sequence

01359BJDEHMMIMJMMMMMMMMIMMMMKMJMMMJJHMMMMMMFGMMMIMMMIMMMJMMMMMAMDJHCDGHMMMJJMJIKMKMIMJMJMMMMMMILMMMMMMHMMIMMJMMMBJMMMDMMJMJKJHJMMJMMJMMMJMMIMMJKMMJMHMMMMMMMMIEMMDMKMJMMIMHMJMMMMMJGIMMMKMJMMMMMMMMHMFMMMMIMMMBMKMKMDJJMMMMIMHMMJMMMIMKMJMMMIMJMJMMHMMMMMMMJMMMDIMMMMIMMMHIMKMMIMMMMMMMJMMJI4MMMMMGHMMMIEMMMMDJJMMMMMJKMKJMMHMMMMMMMMIMMMJKMJMFMMMJMHMMMMLMMDMMMMJIMJMJMMJMHCDGMMMHMMMMMMIKKMJMJMMMJMJMJMMJHMMMMMJIMJMMMMMMIMDMMMMMMMHIMJMMMMMMMMMM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.96% 16.96% 1737
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.46% 14.46% 1737
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.23% 7.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_T11_372
origin="http://chardev.org/?profile=87885"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/frostbolt/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*12) actions+=/frostbolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1737
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Paladin_Retribution_T11_372 : 27217dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27216.8 15.74 / 0.06% 33.6 809.0 780.4 mana 6.06% 54.8
Origin http://chardev.org/?profile=47301
Talents http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
Glyphs
  • the_ascetic_crusader
  • hammer_of_wrath
  • templars_verdict
  • exorcism
  • seal_of_truth

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:31403|21879|21187|10973|9606|8098|8013|2657|2394&chds=0,62806&chco=C0C0C0,C0C0C0,C79C6E,C0C0C0,C79C6E,C0C0C0,C0C0C0,C79C6E,C79C6E&chm=t++31403++exorcism,C0C0C0,0,0,15|t++21879++hammer_of_wrath,C0C0C0,1,0,15|t++21187++templars_verdict,C79C6E,2,0,15|t++10973++consecration,C0C0C0,3,0,15|t++9606++crusader_strike,C79C6E,4,0,15|t++8098++judgement_of_truth,C0C0C0,5,0,15|t++8013++holy_wrath,C0C0C0,6,0,15|t++2657++melee,C79C6E,7,0,15|t++2394++melee,C79C6E,8,0,15&chtt=Paladin_Retribution_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:17,15,13,10,8,8,7,5,5,4,4,1,1,1,0&chds=0,100&chco=C79C6E,C0C0C0,C79C6E,C79C6E,C79C6E,C0C0C0,C0C0C0,C0C0C0,336600,C0C0C0,C0C0C0,C0C0C0,C79C6E,C0C0C0,C0C0C0&chl=templars_verdict|hand_of_light|crusader_strike|melee|seal_of_truth|exorcism|censure|hammer_of_wrath|darkmoon_card_hurricane|judgement_of_truth|seals_of_command|holy_wrath|melee|ancient_fury|consecration&chtt=Paladin_Retribution_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556776556544332111110zyyxxyyyzyzzyyyyxxxwwwwvvtsqoljhfdbaZaaaZZYXXWWVVVWWWWVVUUTTSSSTTTSSSSSRSSSSRRRQQQQPQQQQQQQPPPPPPPPONOOOOOPPQQQRRRRSSSTTSSSSSTTTTTTUUUVVWWWXXXYYYYYXXXWWVVUUUTTTTTTTTTTTTTTTTTTSSSSSSSSSSSSSRRRRRRRRRRRRRRRRRRRRRRRRRRRQQRRQPPPPPPQQRRRRRSSSTTTTTTTTTSSSSSSSTTTTUUUVVVVWWWXXXXXXXXWWWWWWVVVVUUUUUUUUUUUUUUUUVVVVVVVVVVVVVUVUUVUUUUUUUUUUUUUVVVVVVVVUTSSSSTTTTTUUUUUUVVVVVVVVWWWWWWWWWXXXXYYYYYZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbb&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=24568&chtt=Paladin_Retribution_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y011223354567676576456544210zwwvuvvutusrrpmlkjjjijjihhgfgffeeeeeedddddccccccccdcddddeefffggfggfgffffefeedddccccccddeeeffghhijkllmnnooonnmmmllkkjjjiiihhihiijjkklllmmlmmlmlllkjjihhggfeeeddcccccbbbbcbccccccccdddddeeeeeeddddddddddcdccdcdeefgghiijkklmmnnoppppoonmmlkkjiihhhgggfgfggghhiiijjjkkkkkkjkjjjjjiiiiiiiiiiijjjkklklmlmmnpppppooonnmmmlkkjjiiheeeeeeeeeeffgghhiijjklllmmnnoooonnmmmllkkkjjjjjjjjjjjkkklllmmmmmnnmnmmmmmmlllkkkjjjjiiiiiiiiiiiiiiiiiiiiiiiij&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27217|max=45270&chxp=1,1,60,100&chtt=Paladin_Retribution_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,1,3,5,5,9,8,25,31,45,67,75,134,187,213,308,330,385,519,538,600,612,697,616,625,583,535,509,442,370,351,256,246,166,125,105,76,53,43,31,22,15,10,9,3,5,1,2,1&chds=0,697&chbh=5&chxt=x&chxl=0:|min=24173|avg=27217|max=30434&chxp=0,1,49,100&chtt=Paladin_Retribution_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Paladin_Retribution_T11_372 27217
ancient_fury 208 0.8% 3.0 210.51sec 31290 0 28635 58481 103079 9.6% 0.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 93871
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 89.65% 28634.88 0 52503 77016
crit 0.3 9.61% 58480.70 0 103079 16854
dodge 0.0 0.74% 0.00 0 0 0

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Fury, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.061000
  • base_dd_min:207.04
  • base_dd_max:280.11
censure 1996 7.3% 392.0 1.16sec 2303 0 0 0 0 0.0% 0.7% 0.0% 0.0% 193 4233 8716 9.8% 0.0% 99.8%

Stats details: censure

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
391.99 391.99 193.18 193.18 0.0000 2.3366 902689
Direct Results Count Pct Average Min Max Total Damage
hit 389.2 99.29% 0.00 0 0 0
dodge 2.8 0.71% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 174.2 90.18% 4232.55 693 6761 737343
crit 19.0 9.82% 8716.15 1427 13928 165345

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Holy damage every $t1 sec.
  • description:Holy damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
consecration 134 0.5% 4.5 90.43sec 13489 10973 0 0 0 0.0% 0.0% 0.0% 0.0% 54 1019 1574 17.2% 0.0% 9.7%

Stats details: consecration

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.49 4.49 54.37 54.37 1.2293 0.8091 60592
Direct Results Count Pct Average Min Max Total Damage
hit 4.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 45.0 82.77% 1018.76 750 1425 45851
crit 9.4 17.23% 1573.78 1159 2201 14741

Action details: consecration

Static Values
  • id:81297
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:81.33
  • base_dd_max:81.33
crusader_strike 3544 13.0% 110.3 4.09sec 14526 9606 11496 23689 33559 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.33 110.33 0.00 0.00 1.5122 0.0000 1602638
Direct Results Count Pct Average Min Max Total Damage
hit 82.9 75.15% 11495.99 10593 16291 953181
crit 27.4 24.85% 23689.50 21823 33559 649457

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1639.4
  • cooldown:3.21
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.35
darkmoon_card_hurricane 1251 4.6% 92.1 5.43sec 6139 0 5562 11457 11458 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
92.13 92.13 0.00 0.00 0.0000 0.0000 565635
Direct Results Count Pct Average Min Max Total Damage
hit 83.1 90.20% 5561.89 5150 5562 462223
crit 9.0 9.80% 11457.49 10609 11458 103412

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
divine_plea 0 0.0% 3.3 130.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_plea

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.26 3.26 0.00 0.00 1.2257 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: divine_plea

Static Values
  • id:54428
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • description:You gain $o1% of your total mana over $d, but the amount healed by your healing spells is reduced by $s2%.
exorcism 2264 8.3% 27.1 16.06sec 37702 31403 28905 44658 65765 17.3% 0.0% 0.0% 0.0% 78 1931 2984 17.2% 0.0% 34.5%

Stats details: exorcism

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.15 27.15 77.95 77.95 1.2006 2.0000 1023546
Direct Results Count Pct Average Min Max Total Damage
hit 22.4 82.66% 28904.69 20656 42567 648621
crit 4.7 17.34% 44658.46 31914 65765 210257
Tick Results Count Pct Average Min Max Total Damage
hit 64.5 82.76% 1930.93 1380 2842 124566
crit 13.4 17.24% 2983.98 2132 4392 40102

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:7026.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Holy damage per $t2 sec.
  • description:Causes ${(($m1+$M1)/2)+(0.344*$cond($gt($SP,$AP),$SP,$AP))} Holy damage $?s54934[plus ${($m1+$M1)/2*0.0688} over $d ][]to an enemy target. If the target is Undead or Demon, it will always critically hit.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2590.76
  • base_dd_max:2892.33
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.066667
  • base_td:184.28
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
hammer_of_wrath 1418 5.2% 19.4 24.04sec 33020 21879 18973 39079 51898 69.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.42 19.42 0.00 0.00 1.5092 0.0000 641200
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 30.13% 18972.80 12395 25193 111019
crit 13.6 69.87% 39078.72 25533 51898 530181

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • tree:retribution
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • base_cost:-2810.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a hammer that strikes an enemy for $s1 Holy damage. Only usable on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:3814.27
  • base_dd_max:4215.78
hand_of_light 4217 15.5% 175.2 2.57sec 10883 0 10883 0 39962 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.21 175.21 0.00 0.00 0.0000 0.0000 1906854
Direct Results Count Pct Average Min Max Total Damage
hit 175.2 100.00% 10883.25 4240 39962 1906854

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:10593.50
  • base_dd_max:10593.50
holy_wrath 350 1.3% 16.2 25.89sec 9776 8013 8931 13808 18970 17.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.18 16.18 0.00 0.00 1.2200 0.0000 158135
Direct Results Count Pct Average Min Max Total Damage
hit 13.4 82.68% 8931.49 6531 12278 119453
crit 2.8 17.32% 13807.99 10090 18970 38682

Action details: holy_wrath

Static Values
  • id:2812
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:4684.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:Sends bolts of holy power in all directions, causing ${0.61*$SPH+$m1} Holy damage divided among all targets within $a1 yds and stunning all Demons$?s56420[, Dragonkin, Elementals,][] and Undead for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.610000
  • base_dd_min:2435.78
  • base_dd_max:2435.78
inquisition 0 0.0% 12.1 38.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.13 12.13 0.00 0.00 1.1818 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • tree:retribution
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases Holy damage done by $s1%.
  • description:Consumes all Holy Power to increase your Holy Damage by $s1%. Lasts $d per charge of Holy Power consumed.
judgement_of_truth 1000 3.7% 37.0 12.33sec 12229 8098 9933 20456 33880 21.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: judgement_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.98 36.98 0.00 0.00 1.5100 0.0000 452161
Direct Results Count Pct Average Min Max Total Damage
hit 28.9 78.18% 9932.87 5617 16447 287155
crit 8.1 21.82% 20456.25 11570 33880 165006

Action details: judgement_of_truth

Static Values
  • id:31804
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1171.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${1+0.223*$SPH+0.142*$AP} Holy damage to an enemy, increased by 10% for each application of Censure on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
melee 2651 9.7% 160.4 2.83sec 7475 2657 7154 14742 21084 9.9% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.39 160.39 0.00 0.00 2.8127 0.0000 1198829
Direct Results Count Pct Average Min Max Total Damage
hit 106.1 66.14% 7154.06 6573 10235 758849
crit 15.8 9.88% 14741.61 13539 21084 233638
glance 38.5 23.98% 5364.28 4929 7676 206341

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth 2307 8.5% 418.1 1.08sec 2495 0 2260 4656 6715 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.13 418.13 0.00 0.00 0.0000 0.0000 1043345
Direct Results Count Pct Average Min Max Total Damage
hit 377.0 90.17% 2259.61 358 3260 851933
crit 41.1 9.83% 4656.45 738 6715 191412

Action details: seal_of_truth

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3279.1
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
seals_of_command 968 3.6% 419.1 1.08sec 1045 0 946 1949 2798 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seals_of_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
419.14 419.14 0.00 0.00 0.0000 0.0000 437818
Direct Results Count Pct Average Min Max Total Damage
hit 377.9 90.16% 945.93 671 1358 357481
crit 41.2 9.84% 1948.83 1382 2798 80337

Action details: seals_of_command

Static Values
  • id:20424
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Seal of Righteousness, Seal of Truth and Seal of Justice now also deal $s1% weapon damage each time you swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.07
templars_verdict 4581 16.8% 64.9 6.89sec 31923 21187 25920 53373 76800 21.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
64.88 64.88 0.00 0.00 1.5067 0.0000 2071207
Direct Results Count Pct Average Min Max Total Damage
hit 50.7 78.13% 25919.81 23940 37281 1313925
crit 14.2 21.87% 53372.95 49317 76800 757282

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant weapon attack that causes a percentage of weapon damage. Consumes all charges of Holy Power to increase damage dealt: 1 Holy Power: $% Weapon Damage 2 Holy Power: $% Weapon Damage 3 Holy Power: $% Weapon Damage
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.35
pet - guardian_of_ancient_kings 446
melee 446 100.0% 34.0 9.99sec 4354 2394 4629 0 4629 0.0% 0.0% 23.8% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.00 34.00 0.00 0.00 1.8182 0.0000 148020
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 76.22% 4628.68 4629 4629 119954
glance 8.1 23.78% 3471.51 3472 3472 28066

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Paladin_Retribution_T11_372
consecration mana 15.8% 1.0 12882
crusader_strike mana 49.4% 8.9 1639
holy_wrath mana 20.7% 2.1 4684
inquisition holy_power 16.0% 0.0 2
judgement_of_truth mana 11.8% 10.4 1171
templars_verdict holy_power 84.0% 16707.5 2
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29285.1 16.2 0.7%
divine_plea mana 116.6 9763.9 83.7 0.0%
holy_power_crusader_strike holy_power 110.3 146.0 1.3 0.8%
initial_mana none 1.0 25122.0 25122.0 0.0%
judgements_of_the_bold mana 1358.3 197202.6 145.2 0.8%
mp5_regen mana 1809.9 105318.1 58.2 0.6%
replenishment mana 1809.9 11282.3 6.2 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 89.4 300.7sec 3.7sec 13% 100%

Database details

  • id:86700
  • cooldown name:buff_ancient_power
  • tooltip:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.3 0.0 121.0sec 121.0sec 19% 20%

Database details

  • id:31884
  • cooldown name:buff_avenging_wrath
  • tooltip:All damage and healing caused increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 6.3 0.0 77.5sec 77.5sec 21% 21%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
divine_plea 3.3 0.0 131.1sec 131.1sec 6% 6%

Database details

  • id:54428
  • cooldown name:buff_divine_plea
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
divine_purpose 27.9 0.4 15.8sec 15.6sec 12% 34%

Database details

  • id:90174
  • cooldown name:buff_divine_purpose
  • tooltip:Next Holy Power ability consumes no Holy Power and casts as if 3 Holy Power were used.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:15.00%
golemblood_potion 2.0 0.0 414.4sec 414.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
inquisition 4.0 8.1 116.3sec 38.7sec 97% 98%

Database details

  • id:84963
  • cooldown name:buff_inquisition
  • tooltip:Increases Holy damage done by $s1%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_bold 17.9 19.1 25.8sec 12.3sec 75% 75%

Database details

  • id:89906
  • cooldown name:buff_judgements_of_the_bold
  • tooltip:Regaining ${$m1/10}% of your base mana per second.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.5 8.8 35.7sec 20.4sec 44% 45%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
the_art_of_war 27.4 4.7 16.3sec 13.8sec 22% 100%

Database details

  • id:
  • cooldown name:buff_the_art_of_war
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
zealotry 3.9 0.0 125.0sec 125.0sec 17% 17%

Database details

  • id:85696
  • cooldown name:buff_zealotry
  • tooltip:Crusader Strike generates 3 charges of Holy Power.
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
guardian_of_ancient_kings-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
censure

Database details

  • id:31803
  • cooldown name:buff_censure
  • tooltip:Holy damage every $t1 sec.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_pure

Database details

  • id:53657
  • cooldown name:buff_judgements_of_the_pure
  • tooltip:Casting and melee speed increased by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 92.1 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.70%
σ of the average dps 7.8712
2 * σ / μ 0.0578%
95% Confidence Intervall ( μ ± 2σ ) ( 27201.03 - 27232.51 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27193.16 - 27240.38 )
Sample Data
σ 787.1224
Minimum 24173.37
Maximum 30434.43
Spread ( max - min ) 6261.06
Range ( max - min ) / 2 3130.53
Range% 11.50
10th Percentile 26257.49
90th Percentile 28267.31
( 90th Percentile - 10th Percentile ) 2009.82
Approx. Iterations needed for
1% dps error 33
0.1% dps error 3345
0.1 scale factor error with delta=300 5507
0.05 scale factor error with delta=300 22028
0.01 scale factor error with delta=300 550721
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 seal_of_truth
3 snapshot_stats
4 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
5 auto_attack
6 judgement,if=buff.judgements_of_the_pure.down
7 guardian_of_ancient_kings
8 avenging_wrath,if=buff.zealotry.down
9 zealotry,if=buff.avenging_wrath.down
A inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
B templars_verdict,if=holy_power=3
C crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
D templars_verdict,if=buff.divine_purpose.react
E crusader_strike
F hammer_of_wrath
G exorcism,if=buff.the_art_of_war.react
H judgement,if=buff.judgements_of_the_pure.remains<2
I wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
J judgement
K holy_wrath
L consecration
M divine_plea

Sample Sequence

01245678AEFCDCBBBEFCDE9BEBEBCBBEBEAGEBJEKLEMGEBJEGIIIIIEKGEBDEJIIIIIEGIIIIIEAJEGKEIIIIIEBGCDJEKIIIIEBJCDDCDDEAGEJ8DEFGEBJEFKEJEB9DEBGEBJEABEBIIEBIIIEGJEKIIIIIEBDEJLEMIIIIIEBDEGGAEJKEBGCDJELIIIIIEBJCDGEKJIIEBIIIIIEGJEGIIIIIEAKCD8FCDGIEBFIIIIEIIIIIIIIIFCDJIIE9BDEBGAEBGEBJEBKEGJEIIIIIEBDEG7JEKMIEAIIIIIEJIIEGEBGEJKEIIIIIEBJCDLEJEBIIIIIEKAEGJEBGEGJ8EFGEBJEFKEJEBFEJEK9AEBIIIEBJEBIIIIIEBJEBKEGIIIEGJEBIIIIIEMGEJAEBDEFGEJDEBFCDGEFJEBFEKJEFIIEAGEFJEKL8EBFEGJEFIIIIIEBJEF4GEGJEAFEKJEF9DEBFEBJEBFEBGE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7109 5784 5345
Agility 699 117 20
Stamina 7711 6086 5930
Intellect 132 126 20
Spirit 141 141 20
Health 150923 128229 0
Mana 25122 25032 0
Spell Power 5442 3708 0
Spell Hit 17.47% 17.47% 970
Spell Crit 14.08% 9.07% 993
Spell Haste 10.90% 5.61% 719
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 16086 11974 190
Melee Hit 8.08% 8.08% 970
Melee Crit 14.64% 6.77% 993
Melee Haste 5.61% 5.61% 719
Expertise 23.15 13.15 395
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.42% 4.51% 83
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.06% 19.06% 1982

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
tabard empty

Talents

Holy Rank
Arbiter of the Light 2
Protector of the Innocent 0
Judgements of the Pure 3
Clarity of Purpose 0
Last Word 0
Blazing Light 2
Denounce 0
Divine Favor 0
Infusion of Light 0
Daybreak 0
Enlightened Judgements 0
Beacon of Light 0
Speed of Light 0
Sacred Cleansing 0
Conviction 0
Aura Mastery 0
Paragon of Virtue 0
Tower of Radiance 0
Blessed Life 0
Light of Dawn 0
Protection Rank
Divinity 0
Seals of the Pure 2
Eternal Glory 0
Judgements of the Just 0
Toughness 0
Improved Hammer of Justice 0
Hallowed Ground 0
Sanctuary 0
Hammer of the Righteous 0
Wrath of the Lightbringer 0
Reckoning 0
Shield of the Righteous 0
Grand Crusader 0
Vindication 0
Holy Shield 0
Guarded by the Light 0
Divine Guardian 0
Sacred Duty 0
Shield of the Templar 0
Ardent Defender 0
Retribution Rank
Eye for an Eye 2
Crusade 3
Improved Judgement 2
Guardian's Favor 0
Rule of Law 3
Pursuit of Justice 2
Communion 1
The Art of War 3
Long Arm of the Law 2
Divine Storm 1
Sacred Shield 1
Sanctity of Battle 1
Seals of Command 1
Sanctified Wrath 3
Selfless Healer 0
Repentance 1
Divine Purpose 2
Inquiry of Faith 3
Acts of Sacrifice 0
Zealotry 1

Profile

#!./simc

paladin=Paladin_Retribution_T11_372
origin="http://chardev.org/?profile=47301"
level=85
race=human
role=hybrid
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
glyphs=the_ascetic_crusader/hammer_of_wrath/templars_verdict/exorcism/seal_of_truth
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/seal_of_truth
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
actions+=/auto_attack
actions+=/judgement,if=buff.judgements_of_the_pure.down
actions+=/guardian_of_ancient_kings
actions+=/avenging_wrath,if=buff.zealotry.down
actions+=/zealotry,if=buff.avenging_wrath.down
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
actions+=/templars_verdict,if=holy_power=3
actions+=/crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
actions+=/templars_verdict,if=buff.divine_purpose.react
actions+=/crusader_strike
actions+=/hammer_of_wrath
actions+=/exorcism,if=buff.the_art_of_war.react
actions+=/judgement,if=buff.judgements_of_the_pure.remains<2
actions+=/wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
actions+=/judgement
actions+=/holy_wrath
actions+=/consecration
actions+=/divine_plea
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders=reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
chest=reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs=reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands=reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
# Gear Summary # gear_strength=5345
# gear_agility=20
# gear_stamina=5930
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=395
# gear_hit_rating=970
# gear_crit_rating=993
# gear_haste_rating=719
# gear_mastery_rating=1982
# gear_armor=21168
# gear_dodge_rating=83
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide

Priest_Disc_Smite_T11_372 : 11181dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
11180.8 104.77 / 0.94% 6.2 1817.7 1632.7 mana 28.49% 31.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:29373|26107|24216|17232|16118|12214|7738&chds=0,58745&chco=9482C9,9482C9,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9&chm=t++29373++devouring_plague,9482C9,0,0,15|t++26107++shadow_word_pain,9482C9,1,0,15|t++24216++power_word_shield,C0C0C0,2,0,15|t++17232++penance,C0C0C0,3,0,15|t++16118++holy_fire,C0C0C0,4,0,15|t++12214++smite,C0C0C0,5,0,15|t++7738++melee,9482C9,6,0,15&chtt=Priest_Disc_Smite_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:31,29,26,14,13,13,11,5,4,1&chds=0,100&chco=C0C0C0,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9,9482C9,C0C0C0,9482C9,C41F3B&chl=penance|atonement|smite|holy_fire|power_word_shield|shadow_word_pain|devouring_plague|divine_aegis|melee|darkmoon_card_volcano&chtt=Priest_Disc_Smite_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556678764565433554200zxvuuvvvwxxywvvuuuwyxxwvuutrsstrqnooonoqstuvwxyvvvwwwwvvvvusrssrqppppoopppoprstvxy0000011110zyxuttssrstuuusrrsttvutssrqpooopmlmllljjjklmmmmnnmmmkllkkkkkiihggfeeddddccbbbbddefeedccbbbbbaZYXVUUUUUVWWVVUTUVWVVUUTRRQRQOONMMLKKKKJJKLMMNNNPOMLKKKKJJJJIHHGFFFFEEEEEEEEDEGHHGGFFEDDCCCCCCBBBBBBBBBBBBBBBCCCCCCBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCEHJKMNOQRRSSSTTTSSRSSSRRSSSSRRRQQPPRTVXZbdfgghhhhiiiihhggeddddddccbbaZZZZZZZaaZZYYYXXXXXXWW&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=125174&chtt=Priest_Disc_Smite_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:0222345543445577441yvspmkjihhfeccbcbcdaZacdhikjhigjlnpnnnmkmnmoolkjjkijhggfghkjjhffeccddfgihhghhjiiklmmnnnopnlllnmmjiffccdeeedfedffecacehjkjjjhgijkihhfdddfddbYaabbbbaZabdfhhgfeeefgggffffffefeeeefghhhihhghiiihfecbaabcdddcdddeeedefhijlkjjiiiiigfedddeecbbbabbbbbbbcdeffedcbcccbaZaaaaaaaaaabbbcccbbccbbaZYXWVUTSRRRRRRRRRRRRRSSSSSSSSSTTSSRRQQPPPPPPOOOONNNOOOOOOOOOPPPQRTUVXYYZabbddefffffffeedddccbaZYYYZZZZaabbcbcbbcefghihhhhijjkjjjiihhgggfffeeedcbaaaZZaabb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=11181|max=22180&chxp=1,1,50,100&chtt=Priest_Disc_Smite_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,0,2,3,3,7,12,19,34,37,54,62,98,140,150,217,262,339,363,470,521,550,601,607,668,641,628,645,541,482,420,361,299,239,174,104,89,65,46,25,11,4,1,1,1,0,1,0,1&chds=0,668&chbh=5&chxt=x&chxl=0:|min=14575|avg=11181|max=18157&chxp=0,1,-95,100&chtt=Priest_Disc_Smite_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Disc_Smite_T11_372 11181
archangel 0 0.0% 12.5 35.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.45 12.45 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.5 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
atonement 3258 29.1% 72.6 6.11sec 20302 0 17865 27908 44907 24.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: atonement

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.59 72.59 0.00 0.00 0.0000 0.0000 1473742
Direct Results Count Pct Average Min Max Total Damage
hit 55.0 75.74% 17865.49 12678 29066 982300
crit 17.6 24.26% 27908.27 19588 44907 491442

Action details: atonement

Static Values
  • id:81751
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:(null)
  • description:When you deal damage with Smite, you instantly heal a nearby low health friendly party or raid target within $81751A yards from the enemy target equal to a percentage of the damage dealt.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:22508.32
  • base_dd_max:22508.32
darkmoon_card_volcano 72 0.6% 10.2 46.62sec 3216 0 2812 4347 4543 26.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.16 10.16 0.00 0.00 0.0000 0.0000 32671
Direct Results Count Pct Average Min Max Total Damage
hit 7.5 73.67% 2812.01 2773 2940 21044
crit 2.7 26.33% 4347.03 4284 4543 11627

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1220 10.9% 16.5 27.53sec 33514 29373 0 0 0 0.0% 0.0% 0.0% 0.0% 176 2761 4298 24.0% 0.0% 82.5%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.46 16.46 176.32 176.32 1.1410 2.1168 551811
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 134.0 76.02% 2761.01 2566 3398 370053
crit 42.3 23.98% 4298.02 3965 5250 181759

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_aegis 504 4.5% 17.6 24.71sec 12943 0 12943 0 24288 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.61 17.61 0.00 0.00 0.0000 0.0000 227911
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 100.00% 12942.72 8645 24288 227911

Action details: divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Critical heals have a chance to create a protective shield on the target, absorbing a percentage of the amount healed. Lasts $d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:7593.55
  • base_dd_max:7593.55
holy_fire 1581 14.1% 38.4 11.90sec 18641 16118 11610 18077 23631 24.0% 0.0% 0.0% 0.0% 373 497 773 24.1% 0.0% 59.0%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.38 38.38 373.24 373.24 1.1566 0.7150 715381
Direct Results Count Pct Average Min Max Total Damage
hit 29.2 76.03% 11610.19 8408 15295 338738
crit 9.2 23.97% 18077.47 12991 23631 166311
Tick Results Count Pct Average Min Max Total Damage
hit 283.4 75.92% 496.94 363 656 140808
crit 89.9 24.08% 773.45 561 1014 69524

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
penance 3469 31.0% 36.8 12.33sec 42603 17232 0 0 0 0.0% 0.0% 0.0% 0.0% 151 9195 14300 24.4% 0.0% 18.1%

Stats details: penance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.83 36.83 150.63 150.32 2.4723 0.5436 1569041
Direct Results Count Pct Average Min Max Total Damage
none 36.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 113.7 75.64% 9194.65 6654 12142 1045403
crit 36.6 24.36% 14299.86 10281 18760 523638

Action details: penance_tick

Static Values
  • id:47666
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.458000
  • base_dd_min:699.38
  • base_dd_max:790.24

Action details: penance

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • tree:discipline
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2882.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
power_infusion 0 0.0% 4.3 122.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.26 4.26 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3294.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
power_word_shield 1463 13.1% 23.9 18.86sec 27658 24216 27658 0 37307 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.93 23.93 0.00 0.00 1.1421 0.0000 661880
Direct Results Count Pct Average Min Max Total Damage
hit 23.9 100.00% 27658.10 25660 37307 661880

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6300.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $ damage. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.870000
  • base_dd_min:8136.94
  • base_dd_max:8136.94
shadow_fiend 0 0.0% 1.9 300.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.90 1.90 0.00 0.00 1.1799 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1435 12.8% 21.8 20.84sec 29775 26107 0 0 0 0.0% 0.0% 0.0% 0.0% 184 3112 4854 24.1% 0.0% 86.4%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.80 21.80 183.78 183.78 1.1405 2.1265 649124
Direct Results Count Pct Average Min Max Total Damage
hit 21.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 139.5 75.90% 3112.31 2882 3787 434124
crit 44.3 24.10% 4854.33 4452 5851 215000

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 2913 26.1% 72.6 6.11sec 18153 12214 15972 24963 39933 24.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.59 72.59 0.00 0.00 1.4862 0.0000 1317776
Direct Results Count Pct Average Min Max Total Damage
hit 55.0 75.74% 15972.27 11612 25847 878205
crit 17.6 24.26% 24962.57 17941 39933 439571

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 614
melee 614 100.0% 21.2 13.99sec 10465 7738 7846 21124 26819 23.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.21 21.21 0.00 0.00 1.3525 0.0000 221945
Direct Results Count Pct Average Min Max Total Damage
hit 11.2 52.81% 7845.60 505 10057 87871
crit 4.9 23.24% 21124.30 1346 26819 104101
glance 5.1 23.95% 5900.88 379 7543 29974

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.6 60.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.60 5.60 0.00 0.00 1.5291 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.6 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Disc_Smite_T11_372
devouring_plague mana 9.1% 7.4 4540
holy_fire mana 11.3% 7.7 2416
penance mana 17.6% 10.9 3922
power_infusion mana 1.3% 0.0 2521
power_word_shield mana 17.8% 4.5 6104
shadow_word_pain mana 10.5% 7.5 3973
smite mana 32.4% 4.9 3674
Resource Gains Type Count mana Average Overflow
archangel mana 12.5 83395.1 6696.5 2.8%
blessing_of_might mana 1809.9 29378.8 16.2 0.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 4.4 12244.4 2794.8 0.0%
hymn_of_hope_max_mana mana 0.9 16578.9 18746.0 0.0%
initial_mana none 1.0 117810.0 117810.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.9 92720.3 51.2 0.4%
rapture mana 23.9 218430.6 9127.6 1.6%
replenishment mana 1809.9 60883.1 33.6 0.4%
shadow_fiend mana 21.2 88811.5 4187.7 1.4%
spirit_intellect_regen mana 1809.9 120291.9 66.5 0.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 182.3sec 182.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
borrowed_time 23.9 0.0 18.9sec 18.9sec 32% 26%

Database details

  • id:59888
  • cooldown name:buff_borrowed_time
  • tooltip:$s1% spell haste until next spell cast.
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:200.00%
casting 111.3 0.0 4.1sec 4.1sec 32% 32%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 12.5 0.0 35.7sec 35.7sec 49% 83%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 15.6 57.0 29.4sec 6.1sec 89% 83%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 0.9 3.5 0.0sec 1.5sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.5sec 52.5sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_infusion 4.3 0.0 122.5sec 122.5sec 14% 16%

Database details

  • id:
  • cooldown name:buff_power_infusion
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.2sec 47.2sec 26% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 1.9 0.0 300.4sec 0.0sec 6% 6%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 3.8 0.0 129.3sec 129.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
weakened_soul 23.9 0.0 18.9sec 18.9sec 78% 78%

Database details

  • id:6788
  • cooldown name:buff_weakened_soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 5.6 0.0 61.0sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 17.5%
holy_evangelism_1 11.4%
holy_evangelism_2 11.4%
holy_evangelism_3 14.9%
holy_evangelism_4 10.5%
holy_evangelism_5 34.2%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 5.84%
σ of the average dps 52.3846
2 * σ / μ 0.9370%
95% Confidence Intervall ( μ ± 2σ ) ( 11076.03 - 11285.56 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.06% - 100.94% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 11023.64 - 11337.95 )
Sample Data
σ 5238.4582
Minimum 14575.27
Maximum 18156.74
Spread ( max - min ) 3581.47
Range ( max - min ) / 2 1790.73
Range% 16.02
10th Percentile 15838.30
90th Percentile 16954.00
( 90th Percentile - 10th Percentile ) 1115.70
Approx. Iterations needed for
1% dps error 8780
0.1% dps error 878054
0.1 scale factor error with delta=300 243923
0.05 scale factor error with delta=300 975695
0.01 scale factor error with delta=300 24392395
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 power_infusion
A archangel,if=buff.holy_evangelism.stack>=5
B power_word_shield,if=buff.weakened_soul.down
C holy_fire
D devouring_plague,if=remains<tick_time|!ticking
E shadow_word_pain,if=remains<tick_time|!ticking
F penance
G smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCD5EFGGGGGAGCGFBGGEGCDFBCFEAGGGCBDFGGECFBCDFAEGGBGCFGGEC6BDFACGGFBEGGCDF9GBCEFAGGGGCDBFGECFBCFADEGGGBCFGG8ECFBDAGCFEGBGGGCDFBECFAGGGGGCBDFEG9CFBAGCDEFGGBGCGFECBDFAGGGGCFEBGDCFEABCFGGGCEFCGFC8G9CFGCEC67BCDEFGGGGCFBGAEGGDCFGGBGCFEDBCFAGGGEGCFBGDCFEBCAF9GGGGGGBCDEFGCFBEAGGCDFGGCE8

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6994 6191 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 123660 113160 0
Spell Power 10695 8388 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 19.50% 13.27% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 3
Soul Warding 0
Renewed Hope 1
Power Infusion 1
Atonement 2
Inner Focus 1
Rapture 3
Borrowed Time 2
Reflective Shield 0
Strength of Soul 0
Divine Aegis 3
Pain Suppression 1
Train of Thought 2
Focused Will 0
Grace 2
Power Word: Barrier 1
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 3
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 0
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 2
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Disc_Smite_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/power_infusion
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/power_word_shield,if=buff.weakened_soul.down
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/penance
actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Holy_Smite_AA_T11_372 : 8504dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
8503.6 6.36 / 0.07% 5.9 1438.2 1257.1 mana 44.73% 27.8
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:23460|20928|13713|12692|6809&chds=0,46919&chco=9482C9,9482C9,C0C0C0,C0C0C0,9482C9&chm=t++23460++devouring_plague,9482C9,0,0,15|t++20928++shadow_word_pain,9482C9,1,0,15|t++13713++holy_fire,C0C0C0,2,0,15|t++12692++smite,C0C0C0,3,0,15|t++6809++melee,9482C9,4,0,15&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:45,17,17,15,5,1&chds=0,100&chco=C0C0C0,9482C9,C0C0C0,9482C9,9482C9,C41F3B&chl=smite|shadow_word_pain|holy_fire|devouring_plague|melee|darkmoon_card_volcano&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:u6678764444311zywvtqoooomlmmmnnooopooooppoonlljjjijklmoqqstuwyz1122334543210yyxxwvvuvvvvvwwwwvutsrstvvvuutssrqppponnnnnmlllllmmmmnppomlllkjiihhggffggggfeeeefffgijiihggfdcbZZYYYYYYYYZZZZZZZaaaaZYYXXWVVUUUTTTTTTRRQQQQQPPPPQRQQQQPONNMMMLLLLLLKJIIIIIHHHHIJJJIIIHHHGGGGFEEEDDDDDDDDDDDDEFFFEEDDCCCCCCCCCCCCCCCCCBBBCCCCCCCCBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCDEHKQVYbegikkllllkkjiihhggfedcbaaZYXXXXXXYYYZZZZYYYZZYYXWVUTTSRRRRRQQQPPPQQQRSSSSSSSRRQOONNMLLLKKLLLLMMM&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=108339&chtt=Priest_Holy_Smite_AA_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13332467665456751yuroligfeaXUUUTVVWYZadffilnoopqtvvtussqonmjikjfeedccbaaaZZZZZaaZZXXXWVUUTTSTTUWWYZbdeeddddeeffedbaZYXVUSSSTTTTUVWXYZZZZaZZZabZYXXWWVTTSSSTVWYZZZZZZaaabbbbbaZZXWWUTSTSSTTUVWXZabccccddeeeeddccaZYXVVVVVWWWWWWXXYZZabcccbbbaaYYXWWWWVVWVWWWXXXWWWWXXXXXXWVUUTSSRRSSTTTTTTUUUUUVVVVVVVUUTSSRRQQQQQQQQPQPPPPPPPPPPPQQPPPPPPPPPPPPPPPQQRRSSTTUUUWWXZacdfghiijkkmnoopppponmljihfecbaZYXWVUUUUVVWXXYZaabaaaaZZZZYXWVUTTSSSTTUWWXXYZZabbcccbbaaZZYXXWWVVUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=8504|max=19691&chxp=1,1,43,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,2,2,8,8,17,12,19,29,41,64,80,83,105,151,206,245,279,291,375,402,438,542,576,598,593,585,583,583,497,470,425,336,297,287,215,155,112,98,69,41,29,18,13,7,6,3,0,2&chds=0,598&chbh=5&chxt=x&chxl=0:|min=7272|avg=8504|max=9619&chxp=0,1,52,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Holy_Smite_AA_T11_372 8504
archangel 0 0.0% 13.4 34.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.42 13.42 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 13.4 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
chakra 0 0.0% 10.8 43.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.82 10.82 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.8 100.00% 0.00 0 0 0

Action details: chakra

Static Values
  • id:14751
  • school:physical
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • description:When activated, your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite will put you into a Chakra state for $81208d. |CFFFFFFFFSerenity (Heal, Flash Heal, Greater Heal, Binding Heal)|R Increases the critical effect chance of your direct healing spells by $81208s1%, and causes your direct heals to refresh the duration of your Renew on the target. |CFFFFFFFFSanctuary (Prayer of Healing, Prayer of Mending)|R Increases the healing done by your area of effect spells and Renew by $81206s1% and reduces the cooldown of your Circle of Healing by $/1000;81206m2 sec. |CFFFFFFFFChastise (Smite, Mind Spike)|R Increases your total damage done by Shadow and Holy spells by $81209s1%.
darkmoon_card_volcano 57 0.7% 10.1 46.82sec 2538 0 2663 4116 4287 20.4% 15.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.12 10.12 0.00 0.00 0.0000 0.0000 25686
Direct Results Count Pct Average Min Max Total Damage
hit 6.5 63.83% 2662.68 2629 2775 17197
crit 2.1 20.38% 4116.50 4062 4287 8489
miss 1.6 15.79% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1284 15.1% 20.8 22.02sec 27914 23460 0 0 0 0.0% 15.7% 0.0% 0.0% 180 2859 4452 22.7% 0.0% 90.4%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.82 20.82 180.37 180.37 1.1899 2.2682 581058
Direct Results Count Pct Average Min Max Total Damage
hit 17.5 84.29% 0.00 0 0 0
miss 3.3 15.71% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 139.4 77.26% 2859.23 2297 3457 398436
crit 41.0 22.74% 4452.35 3549 5341 182622

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
holy_fire 1410 16.6% 38.6 11.86sec 16532 13713 12436 19339 24678 19.0% 15.5% 0.0% 0.0% 303 534 831 22.4% 0.0% 51.2%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.57 38.57 302.56 302.56 1.2055 0.7650 637617
Direct Results Count Pct Average Min Max Total Damage
hit 25.3 65.52% 12436.43 7733 15973 314300
crit 7.3 18.98% 19338.74 11947 24678 141538
miss 6.0 15.50% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 234.7 77.56% 534.08 334 686 125333
crit 67.9 22.44% 831.38 517 1061 56446

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.571000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 2.0 300.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 1.2130 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1485 17.5% 27.1 16.88sec 24800 20928 0 0 0 0.0% 15.6% 0.0% 0.0% 187 3187 4960 22.6% 0.0% 93.7%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.09 27.09 187.24 187.24 1.1850 2.2638 671759
Direct Results Count Pct Average Min Max Total Damage
hit 22.9 84.37% 0.00 0 0 0
miss 4.2 15.63% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 144.9 77.41% 3187.23 2587 3862 461967
crit 42.3 22.59% 4959.80 3997 5967 209792

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3816 44.9% 88.2 5.06sec 19577 12692 17372 27080 41431 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.18 88.18 0.00 0.00 1.5425 0.0000 1726348
Direct Results Count Pct Average Min Max Total Damage
hit 68.1 77.28% 17371.67 10600 26816 1183841
crit 20.0 22.72% 27080.00 16377 41431 542507

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 562
melee 562 100.0% 22.2 14.84sec 9219 6809 7318 19800 24133 22.2% 5.9% 24.2% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.16 22.16 0.00 0.00 1.3539 0.0000 204320
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 47.66% 7317.95 505 9050 77303
crit 4.9 22.19% 19799.87 1346 24133 97398
glance 5.4 24.19% 5523.60 379 6787 29619
dodge 1.3 5.95% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 62.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.99 5.99 0.00 0.00 1.5303 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Holy_Smite_AA_T11_372
devouring_plague mana 14.8% 6.0 4632
holy_fire mana 14.9% 6.6 2506
shadow_word_pain mana 17.0% 6.1 4076
smite mana 53.3% 5.0 3936
Resource Gains Type Count mana Average Overflow
archangel mana 13.4 82405.1 6139.2 0.3%
blessing_of_might mana 1809.9 29436.8 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 5.0 12719.9 2544.9 0.0%
hymn_of_hope_max_mana mana 1.0 17229.6 17229.6 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1809.9 92902.6 51.3 0.2%
replenishment mana 1809.9 55239.7 30.5 0.2%
shadow_fiend mana 20.8 83110.7 3987.1 0.0%
spirit_intellect_regen mana 1809.9 179762.9 99.3 0.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 7% 11%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 127.1 0.0 3.6sec 3.6sec 39% 39%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_chastise 1.0 9.6 347.7sec 44.1sec 99% 98%

Database details

  • id:81209
  • cooldown name:buff_chakra_chastise
  • tooltip:Increases the damage done by your Shadow and Holy spells by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_pre 10.8 0.0 43.8sec 43.8sec 17% 19%

Database details

  • id:14751
  • cooldown name:buff_chakra_pre
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state for $81208d.
  • max_stacks:1
  • duration:-0.00
  • cooldown:30.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.8sec 46.8sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 13.4 0.0 34.0sec 34.0sec 52% 52%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.2 72.0 28.5sec 5.1sec 93% 82%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 1.0 4.0 0.0sec 1.6sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 9.9 0.0 47.7sec 47.7sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 2.0 0.0 300.3sec 0.0sec 7% 7%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.5 0.2 118.9sec 105.1sec 6% 6%

Database details

  • id:
  • cooldown name:buff_surge_of_light
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 4.0 0.0 124.8sec 124.8sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 6.0 0.0 62.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 18.8%
holy_evangelism_1 10.9%
holy_evangelism_2 12.3%
holy_evangelism_3 12.9%
holy_evangelism_4 14.2%
holy_evangelism_5 30.9%

Procs

Count Interval
surge_of_light 2.7 105.0sec

Statistics & Data Analysis

DPS
Population
Convergence 71.11%
σ of the average dps 3.1804
2 * σ / μ 0.0748%
95% Confidence Intervall ( μ ± 2σ ) ( 8497.28 - 8510.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 8494.09 - 8513.18 )
Sample Data
σ 318.0396
Minimum 7271.60
Maximum 9619.28
Spread ( max - min ) 2347.68
Range ( max - min ) / 2 1173.84
Range% 13.80
10th Percentile 8102.96
90th Percentile 8925.01
( 90th Percentile - 10th Percentile ) 822.05
Approx. Iterations needed for
1% dps error 55
0.1% dps error 5595
0.1 scale factor error with delta=300 899
0.05 scale factor error with delta=300 3596
0.01 scale factor error with delta=300 89910
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 chakra
A archangel,if=buff.holy_evangelism.stack>=5
B holy_fire
C devouring_plague,if=remains<tick_time|!ticking
D shadow_word_pain,if=remains<tick_time|!ticking
E smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BC5DEEEEEAEEEBEEEEEDBCBDDE9EEEBE6ACCEEEBDEEBCD9BAEEEEEEEBDDCBAEEDBEE9ECBDDBAEEECEEBED9BCAEDBEEEE8BDCBAEEEEB9DECBDBAEEEEEECBED9DBDAEEBEEBDEBACEE9EBDEBEACEBEE9BD67BCE8EDEEEAEBEEEEEECBCDB9AEEDEBCEEBDBAECEEE9EEBDBCAEDEBEEE9BCDBAEEEEBDBCEBE9EBDD

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 1.40% 1.40% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 25.10% 19.14% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 0
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 2
Empowered Healing 3
Divine Fury 3
Desperate Prayer 1
Surge of Light 1
Inspiration 2
Divine Touch 2
Holy Concentration 2
Lightwell 1
Tome of Light 2
Rapid Renewal 1
Spirit of Redemption 1
Serendipity 2
Body and Soul 0
Chakra 1
Revelations 1
Blessed Resilience 0
Test of Faith 2
State of Mind 2
Circle of Healing 1
Guardian Spirit 1
Shadow Rank
Darkness 0
Improved Shadow Word: Pain 0
Veiled Shadows 1
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 0
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Holy_Smite_AA_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/chakra
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Shadow_T11_372 : 27113dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27113.1 9.97 / 0.04% 17.2 1572.1 1589.7 mana 0.00% 37.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
Glyphs
  • spirit_tap
  • inner_fire
  • psychic_scream
  • fading
  • fortitude
  • levitate
  • shadow_word_pain
  • shadow_word_death
  • mind_flay

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:81666|65308|35512|30205|25670|23347|21632|11610|7296&chds=0,163331&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++81666++devouring_plague,9482C9,0,0,15|t++65308++vampiric_touch,9482C9,1,0,15|t++35512++mind_blast_3,9482C9,2,0,15|t++30205++mind_blast_2,9482C9,3,0,15|t++25670++mind_blast_1,9482C9,4,0,15|t++23347++shadow_word_death,9482C9,5,0,15|t++21632++mind_blast_0,9482C9,6,0,15|t++11610++mind_flay,9482C9,7,0,15|t++7296++melee,9482C9,8,0,15&chtt=Priest_Shadow_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x330&cht=p&chf=bg,s,333333&chd=t:29,20,11,10,6,5,4,4,4,3,3,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B&chl=mind_flay|vampiric_touch|shadow_word_pain|devouring_plague|mind_blast_3|melee|mind_blast_2|shadow_word_death|shadowy_apparition|mind_blast_1|devouring_plague_burst|mind_blast_0|darkmoon_card_volcano&chtt=Priest_Shadow_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ckkkllmou5677420xwvupnmlkkkkjjihhhhhggffffffeedcbbbbbaaaaZZZYYYYYXXXXXWWVVVVUUUUVVVVVVVVVWWWWWWVVWWYadfghijjjjjjjjjiihhggggffffffeedddcccccbbaaZZZYYYYXXXXXXXWWWWVVVVUUUUUUUUUUUUUUUUUUUUUUTTTUWYbcdefggggffffffffeeddcccbbbbbbaaaaZZZZYYXXWWWWVVVVVVUUUUUUUUUTTTSSSRRRRRRRRRRRRRRRRRSSSRRSTUWYabcdddddddddddddcccbbbbbbbbbaaaaaaaaaaaaZZZZZZZZZZZZZZZZaaaaaaaaZZZZZZZZZZZZZZaaaaaaabbbcegijkllllllkkkkkkkkkjjjiiiiiijjjjjjjjjjjkkkkkkkkkklllmmmmmmmmmmmmmmmmlllllll&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=168308&chtt=Priest_Shadow_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uxx222121214577655321zxwssqrqqoomlkklkjiiiiihihighgggghhhgghhhhghggfffffffffeeeeddeeffffgggghhiiijjkkkkkkkkkkkkkjjjiihhgggfffeeeeeeeeeeeeffgggghhhhhhhhhhhhiiihhhggggggggggggggggghhiijjkklllmmmmmmmmmmlllkkjiihhgggggffffeeeddeeeeffffffggggghhhhhhhhhhhhhggggggggggffffffffgghhhhhhiiijjjkkkkkkkkkkkkkjjjiihhgggffffffeeeefffffgghhiiiiijjjjjjjjjjjjjjiiiihhhhhhhhhiiiiijjkllmmnnooppqqqqqqqqqqppponnmmmllkkjjjiiihhhhhhhiiiijjjkkllllmmmmmmmmmllllllkkjjjjjjjjiii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27113|max=45645&chxp=1,1,59,100&chtt=Priest_Shadow_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,7,9,7,21,29,42,65,92,127,176,196,283,342,373,438,480,529,583,582,590,602,543,560,511,473,381,351,326,286,251,180,125,108,78,53,60,44,37,18,14,7,7,2,2,2,1,1,1,1&chds=0,602&chbh=5&chxt=x&chxl=0:|min=25554|avg=27113|max=29269&chxp=0,1,42,100&chtt=Priest_Shadow_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Shadow_T11_372 27113
archangel 0 0.0% 5.3 92.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.30 5.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
darkmoon_card_volcano 79 0.3% 10.2 46.27sec 3501 0 3087 4776 5217 24.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 35822
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 75.50% 3086.64 3023 3377 23846
crit 2.5 24.50% 4775.94 4671 5217 11976

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 4240 15.6% 20.2 22.87sec 94734 81666 0 0 0 0.0% 0.0% 0.0% 0.0% 203 4709 9899 22.6% 0.0% 99.0%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 203.49 203.49 1.1600 2.2010 1196891
Direct Results Count Pct Average Min Max Total Damage
hit 20.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 157.5 77.40% 4708.55 3527 7073 741566
crit 46.0 22.60% 9898.52 7371 14783 455325

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4786.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
devouring_plague_burst 797 2.9% 20.2 22.87sec 17805 0 14247 29987 44363 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.24 20.24 0.00 0.00 0.0000 0.0000 360439
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 77.40% 14247.14 10585 21227 223223
crit 4.6 22.60% 29986.82 22122 44363 137217

Action details: devouring_plague_burst

Static Values
  • id:0
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:7650.81
  • base_dd_max:7650.81
mind_blast_0 317 1.2% 5.7 72.68sec 25255 21632 20013 42505 61859 23.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_0

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.68 5.68 0.00 0.00 1.1675 0.0000 143398
Direct Results Count Pct Average Min Max Total Damage
hit 4.4 76.69% 20012.82 17287 29598 87148
crit 1.3 23.31% 42504.51 36130 61859 56250

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_1 875 3.2% 13.1 33.14sec 30239 25670 24115 50968 85225 22.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_1

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.09 13.09 0.00 0.00 1.1780 0.0000 395850
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 77.19% 24114.57 20772 40778 243685
crit 3.0 22.81% 50967.98 43413 85225 152165

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_2 1092 4.0% 13.8 30.18sec 35676 30205 28485 60111 108591 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_2

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.84 13.84 0.00 0.00 1.1811 0.0000 493755
Direct Results Count Pct Average Min Max Total Damage
hit 10.7 77.26% 28484.89 24256 51957 304592
crit 3.1 22.74% 60111.10 50695 108591 189164

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_3 1553 5.7% 16.8 25.50sec 41709 35512 33235 70497 131957 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_3

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.84 16.84 0.00 0.00 1.1745 0.0000 702253
Direct Results Count Pct Average Min Max Total Damage
hit 13.0 77.26% 33234.85 27740 63137 432312
crit 3.8 22.74% 70497.04 57977 131957 269940

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_flay 7828 28.9% 123.0 3.64sec 28782 11610 0 0 0 0.0% 0.0% 0.0% 0.0% 368 7347 15520 27.8% 0.0% 60.6%

Stats details: mind_flay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.01 123.01 368.06 368.06 2.4790 0.7453 3540442
Direct Results Count Pct Average Min Max Total Damage
hit 123.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 265.8 72.20% 7347.25 6348 11550 1952539
crit 102.3 27.80% 15520.10 13267 24139 1587904

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1647.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement speed slowed.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d and slowing their movement speed by $s2%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.257000
  • base_td:167.30
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 5.3 91.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.28 5.28 0.00 0.00 1.1382 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_death 1069 3.9% 17.6 6.31sec 27406 23347 21817 46092 67863 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.65 17.65 0.00 0.00 1.1739 0.0000 483687
Direct Results Count Pct Average Min Max Total Damage
hit 13.6 76.98% 21816.72 18828 32471 296398
crit 4.1 23.02% 46091.73 39351 67863 187289

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2297.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s1 Shadow damage to the target. Deals three times as much damage to targets below 25% health. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.282000
  • base_dd_min:301.52
  • base_dd_max:301.52
shadow_word_pain 4082 15.1% 1.0 392.90sec 1840465 1773883 0 0 0 0.0% 0.0% 0.0% 0.0% 202 5504 11616 22.8% 0.0% 99.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 202.20 202.20 1.0375 2.2326 1394782
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 156.1 77.20% 5504.49 4172 7893 859230
crit 46.1 22.80% 11615.83 8719 16497 535552

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowy_apparition 998 3.7% 28.8 15.45sec 15658 0 12304 25966 33601 28.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.84 27.79 0.00 0.00 0.0000 0.0000 451573
Direct Results Count Pct Average Min Max Total Damage
hit 19.8 71.12% 12304.18 11165 16077 243160
crit 8.0 28.88% 25965.88 23334 33601 208413

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you deal periodic damage with your Shadow Word: Pain, you have a chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal shadow damage. While moving, the chance to summon the shadowy apparation is increased.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.515000
  • base_dd_min:516.19
  • base_dd_max:516.19

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch 5493 20.3% 32.4 14.10sec 76675 65308 0 0 0 0.0% 0.0% 0.0% 0.0% 200 9903 20868 22.8% 0.0% 98.3%

Stats details: vampiric_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.40 32.40 200.26 200.26 1.1740 2.2193 2484272
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.6 77.18% 9903.23 7266 14725 1530715
crit 45.7 22.82% 20868.09 15185 30776 953557

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3294.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $o2 Shadow damage over $d to your target and causes up to 10 party or raid members to gain 1% of their maximum mana per 10 sec when you deal damage from Mind Blast.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.400000
  • base_td:108.70
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - shadow_fiend 1413
melee 1413 100.0% 58.6 7.05sec 9907 7296 7470 20293 26754 22.4% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.55 58.55 0.00 0.00 1.3578 0.0000 580106
Direct Results Count Pct Average Min Max Total Damage
hit 31.4 53.64% 7469.73 505 10033 234627
crit 13.1 22.44% 20293.09 1346 26754 266643
glance 14.0 23.92% 5629.29 379 7525 78835

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 15.7 27.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.69 15.69 0.00 0.00 1.5328 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Shadow_T11_372
devouring_plague mana 13.6% 19.8 4786
mind_blast_0 mana 2.8% 7.2 3500
mind_blast_1 mana 6.4% 8.6 3500
mind_blast_2 mana 6.8% 10.2 3500
mind_blast_3 mana 8.3% 11.9 3500
mind_flay mana 28.5% 17.5 1647
shadow_word_death mana 5.7% 11.9 2297
shadow_word_pain mana 0.6% 437.1 4211
vampiric_touch mana 15.0% 23.3 3294
Resource Gains Type Count mana Average Overflow
archangel mana 5.3 186066.1 35084.3 3.0%
blessing_of_might mana 1809.9 28215.4 15.6 4.4%
dispersion mana 0.0 298.4 7671.2 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
masochism mana 17.6 154794.4 8770.6 12.9%
mp5_regen mana 1809.9 89071.7 49.2 4.3%
replenishment mana 1809.9 53465.0 29.5 4.5%
shadow_fiend mana 58.6 201273.7 3437.4 11.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.4sec 181.4sec 7% 9%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 82.1 0.0 5.5sec 5.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_archangel 5.3 0.0 92.4sec 92.4sec 21% 23%

Database details

  • id:87153
  • cooldown name:buff_dark_archangel
  • tooltip:Damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death increased by $w1%.
  • max_stacks:1
  • duration:18.00
  • cooldown:90.00
  • default_chance:100.00%
dark_evangelism 6.3 484.8 75.9sec 0.9sec 98% 96%

Database details

  • id:81661
  • cooldown name:buff_dark_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
empowered_shadow 1.0 48.4 387.5sec 9.2sec 99% 98%

Database details

  • id:95799
  • cooldown name:buff_empowered_shadow
  • tooltip:$w1% increased periodic shadow damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
glyph_of_shadow_word_death 8.9 0.0 13.2sec 13.2sec 11% 11%

Database details

  • id:
  • cooldown name:buff_glyph_of_shadow_word_death
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.9sec 51.9sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
power_torrent_mh 10.1 0.0 47.0sec 47.0sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
self_movement 9.0 0.0 13.1sec 13.1sec 5% 5%

Database details

  • id:
  • cooldown name:buff_self_movement
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_orb 44.3 58.3 10.2sec 4.4sec 58% 89%

Database details

  • id:77487
  • cooldown name:buff_shadow_orb
  • tooltip:Consumed to increase damage done by Mind Blast or Mind Spike.
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend 5.3 0.0 91.9sec 0.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.2 0.0 117.2sec 117.2sec 18% 18%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.6sec 414.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 2%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 15.7 0.0 27.5sec 0.0sec 16% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_form

Database details

  • id:
  • cooldown name:buff_shadow_form
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace

Database details

  • id:
  • cooldown name:buff_vampiric_embrace
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 4.4%
dark_evangelism_1 0.1%
dark_evangelism_2 0.8%
dark_evangelism_3 0.7%
dark_evangelism_4 2.5%
dark_evangelism_5 91.5%
holy_evangelism_0 100.0%
mind_spike_0 100.0%
shadow_orb_0 11.5%
shadow_orb_1 26.5%
shadow_orb_2 28.0%
shadow_orb_3 34.1%

Procs

Count Interval
shadowy_apparation_proc 28.8 15.5sec

Statistics & Data Analysis

DPS
Population
Convergence 71.04%
σ of the average dps 4.9833
2 * σ / μ 0.0368%
95% Confidence Intervall ( μ ± 2σ ) ( 27103.10 - 27123.03 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27098.12 - 27128.02 )
Sample Data
σ 498.3322
Minimum 25553.65
Maximum 29268.65
Spread ( max - min ) 3715.00
Range ( max - min ) / 2 1857.50
Range% 6.85
10th Percentile 26506.36
90th Percentile 27781.03
( 90th Percentile - 10th Percentile ) 1274.66
Approx. Iterations needed for
1% dps error 13
0.1% dps error 1351
0.1 scale factor error with delta=300 2207
0.05 scale factor error with delta=300 8829
0.01 scale factor error with delta=300 220742
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 shadow_form
5 vampiric_embrace
6 snapshot_stats
7 volcanic_potion,if=!in_combat
8 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 mind_blast,if=buff.shadow_orb.stack>=1
A berserking
B shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains<gcd+0.5)&miss_react
C devouring_plague,if=(!ticking|dot.devouring_plague.remains<gcd+1.0)&miss_react
D stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains<cast_time+2.5
E vampiric_touch,if=(!ticking|dot.vampiric_touch.remains<cast_time+2.5)&miss_react
F start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
G archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
H shadow_word_death,health_percentage<=25
I shadow_fiend
J mind_blast
K mind_flay
L dispersion,moving=1
M devouring_plague,moving=1,if=mana_pct>10
N shadow_word_death,moving=1
O dispersion

Sample Sequence

013457ABC9EIKKGK9KKKE9KKCK9KKEK9KKKK9CEKKJKKEK9KKCK9EKIK9KKEK9CKKK9EGKK9KKCEJKKK9KEKK9CKKE9KKK9KEKC9KKK9EKKK9AKCEK9KKGK9IEKK9CKKEJKKKJKEKCJKKK9EKKK9KCEK9KKK9EKKC9KKE9GKIK9KEKC9KKK9EKKK9KCEK9KKK9EKKC9KKEKJKKAK9EKCKI9KGKK9EKKKCJKEKK9KFHHDEK9KCFMHHD9EKKK9FHHDKEKCJFMHHDKK9EKFHHDK9KCEFGMHHD9KKK9EFHHDIKJKCEFHHD9K8KK9EFHHDKK9CKEFHHDJKKK9EFHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 23897 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 2
Evangelism 2
Archangel 1
Inner Sanctum 2
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 0
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 2
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 3
Improved Devouring Plague 2
Twisted Faith 2
Shadowform 1
Phantasm 0
Harnessed Shadows 2
Silence 0
Vampiric Embrace 1
Masochism 2
Mind Melt 2
Pain and Suffering 2
Vampiric Touch 1
Paralysis 0
Psychic Horror 0
Sin and Punishment 2
Shadowy Apparition 3
Dispersion 1

Profile

#!./simc

priest=Priest_Shadow_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
glyphs=spirit_tap/inner_fire/psychic_scream/fading/fortitude/levitate/shadow_word_pain/shadow_word_death/mind_flay
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/shadow_form
actions+=/vampiric_embrace
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mind_blast,if=buff.shadow_orb.stack>=1
actions+=/berserking
actions+=/shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains actions+=/devouring_plague,if=(!ticking|dot.devouring_plague.remains actions+=/stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains actions+=/vampiric_touch,if=(!ticking|dot.vampiric_touch.remains actions+=/start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
actions+=/archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
actions+=/shadow_word_death,health_percentage<=25
actions+=/shadow_fiend
actions+=/mind_blast
actions+=/mind_flay
actions+=/dispersion,moving=1
actions+=/devouring_plague,moving=1,if=mana_pct>10
actions+=/shadow_word_death,moving=1
actions+=/dispersion
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Rogue_Assassination_T11_372 : 27280dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27280.5 12.08 / 0.04% 1022.0 26.7 26.5 energy 42.04% 36.3
Origin http://chardev.org/?profile=36311
Talents http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
Glyphs
  • expose_armor
  • mutilate
  • backstab
  • rupture

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27535|18286|16510|14305|10452|3224|1610&chds=0,55069&chco=336600,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E&chm=t++27535++envenom,336600,0,0,15|t++18286++garrote,C55D54,1,0,15|t++16510++mutilate,C79C6E,2,0,15|t++14305++backstab,C79C6E,3,0,15|t++10452++rupture,C55D54,4,0,15|t++3224++melee_main_hand,C79C6E,5,0,15|t++1610++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Assassination_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,14,12,10,10,9,7,6,4,2,1&chds=0,100&chco=336600,336600,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54&chl=instant_poison|envenom|melee_main_hand|deadly_poison|venomous_wound|backstab|mutilate_mh|melee_off_hand|mutilate_oh|rupture|garrote&chtt=Rogue_Assassination_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:m2671uwvstvrtrtsnkmkjhedccbbbbXWXXYZZaabbbbbbbbccbbbaYXXWWVVVVUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVUUUUUUUUUUUUUUUUUUUUUUUUUVXWVVVVWWXXXXWWWWWVVVVVVUUUUUUUUUUUUUUUUVUUVVVVVVVVVVVUUUUUVVVVWWWWWWVVVVUUUUUUUUUUUUUUUUTTTTTTTUVVVWWXXYYYYYZZZZYYYYYYXYabZYXXYYYZZZZZaaaZZZZZZZYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZZZaaaaaaaaaabbbbbbcccccddddddddddddddddddeeeeeeeeeeeeeeeeeeeefgillkjiiiiihhhiiiiiiiiiihhhhhgfedccdefghiklmnopqrrrrrqqponmlkjjiihhgggffffffffffffeeeeeeee&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=102&chtt=Rogue_Assassination_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:zz221233443467877421zxxuutrqponnnmmllkkkjjjiiiihggfffeedddcccbbbbbaaaabaabbbbbbbbbcccccccccccccccccbbbbbbbbaaaaaaabbbcccddeeefffggghhhihhhhhhhhggffffeeeeddddddcccccccccccccccccddddddddcccccccccccbbbbbaaaaaaaaabbbbccccdddeeefffggggggfffgggggghhhhhiiijjjjkkkkkkkjjjjiihhhggfffeeeddddccccccccccccccccccccccccdddddddddeeeeeeeeffffffffffffffffffeeeeeeeeeeeffffgghiijjkklllmmnnooopppoooooonnnmmmmlllllllllllllllmmmmmmmmmlllkkkjjiiihhhhggggggggfffffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27280|max=49426&chxp=1,1,55,100&chtt=Rogue_Assassination_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,5,8,5,8,13,30,41,68,67,111,139,174,219,262,308,385,359,484,463,565,542,527,565,514,504,481,472,448,347,370,274,248,225,195,133,107,95,65,50,30,25,23,16,14,8,2,1,2&chds=0,565&chbh=5&chxt=x&chxl=0:|min=25234|avg=27280|max=29444&chxp=0,1,49,100&chtt=Rogue_Assassination_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Assassination_T11_372 27280
backstab 2478 9.1% 76.7 2.08sec 14620 14305 8263 19705 25502 59.1% 4.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
76.70 76.70 0.00 0.00 1.0220 0.0000 1121347
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 36.10% 8262.73 7521 10724 228780
crit 45.3 59.06% 19704.51 17886 25502 892567
dodge 3.7 4.84% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
deadly_poison 2847 10.4% 346.4 1.30sec 3718 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 8022 12397 13.0% 0.0% 99.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
346.45 1.02 149.89 149.89 0.0000 3.0000 1288057
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 130.3 86.95% 8022.28 1449 10870 1045587
crit 19.6 13.05% 12396.53 2239 16794 242470

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
envenom 3940 14.4% 63.0 7.15sec 28310 27535 20406 43375 63153 38.8% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.97 62.97 0.00 0.00 1.0282 0.0000 1782637
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 56.36% 20406.40 8076 30657 724162
crit 24.4 38.76% 43374.62 16638 63153 1058475
dodge 3.1 4.89% 0.00 0 0 0

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deadly Poison application chance increased by $s3%. Instant Poison application frequency increased by $s2%.
  • description:Finishing move that consumes your Deadly Poison and deals instant poison damage. Following the Envenom attack your Deadly Poison application chance is increased by $s3%, and your Instant Poison application frequency by $s2%, for 1 sec plus an additional 1 sec per combo point. Poison doses, up to the number of combo points spent, are consumed to increase Envenom's damage: 1 point : ${$AP*0.09*$+($m1*1)} damage 2 points: Up to ${$AP*0.18*$+($m1*2)} damage 3 points: Up to ${$AP*0.27*$+($m1*3)} damage 4 points: Up to ${$AP*0.36*$+($m1*4)} damage 5 points: Up to ${$AP*0.45*$+($m1*5)} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:1203.99
  • base_dd_max:1203.99
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
garrote 159 0.6% 3.8 128.57sec 18961 18286 0 0 0 0.0% 5.0% 0.0% 0.0% 21 2612 5421 27.2% 0.0% 14.1%

Stats details: garrote

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.80 3.80 21.33 21.33 1.0369 3.0000 71993
Direct Results Count Pct Average Min Max Total Damage
hit 3.6 95.02% 0.00 0 0 0
dodge 0.2 4.98% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 15.5 72.81% 2611.53 2341 3587 40558
crit 5.8 27.19% 5421.50 4823 7044 31435

Action details: garrote

Static Values
  • id:703
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for $1330d and causing ${($m1+$AP*$*0.07)*6} damage over $d, increased by your attack power. Must be stealthed and behind the target. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.070000
  • base_td:132.78
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 6654 24.4% 673.3 0.70sec 4471 0 4174 6450 8655 13.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
673.30 673.30 0.00 0.00 0.0000 0.0000 3010525
Direct Results Count Pct Average Min Max Total Damage
hit 585.5 86.95% 4174.47 3736 5602 2443992
crit 87.8 13.05% 6449.73 5773 8655 566532

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3222 11.8% 461.6 0.98sec 3158 3224 2977 6167 8086 26.9% 16.7% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
461.56 461.56 0.00 0.00 0.9795 0.0000 1457622
Direct Results Count Pct Average Min Max Total Damage
hit 149.5 32.38% 2976.63 2695 3925 444860
crit 124.0 26.87% 6167.18 5551 8086 764735
glance 110.8 24.01% 2238.26 2021 2944 248027
dodge 22.5 4.87% 0.00 0 0 0
miss 54.8 11.88% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1609 5.9% 592.6 0.76sec 1229 1610 1158 2399 3146 26.9% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
592.55 592.55 0.00 0.00 0.7631 0.0000 728019
Direct Results Count Pct Average Min Max Total Damage
hit 191.9 32.38% 1158.12 1048 1527 222236
crit 159.3 26.88% 2399.13 2160 3146 382110
glance 142.0 23.97% 870.81 786 1145 123674
dodge 28.8 4.86% 0.00 0 0 0
miss 70.6 11.91% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 2964 10.9% 79.3 3.65sec 16905 16510 0 0 0 0.0% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.32 79.32 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 75.5 95.14% 0.00 0 0 0
dodge 3.9 4.86% 0.00 0 0 0

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
mutilate_mh 1977 7.2% 75.5 3.84sec 11852 0 7180 17151 22115 46.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.46 75.46 0.00 0.00 0.0000 0.0000 894399
Direct Results Count Pct Average Min Max Total Damage
hit 40.1 53.15% 7179.80 6476 9300 287956
crit 35.4 46.85% 17151.30 15399 22115 606443

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
mutilate_oh 987 3.6% 75.5 3.84sec 5917 0 3585 8558 11034 46.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.46 75.46 0.00 0.00 0.0000 0.0000 446490
Direct Results Count Pct Average Min Max Total Damage
hit 40.1 53.12% 3585.18 3230 4640 143718
crit 35.4 46.88% 8558.15 7680 11034 302772

Action details: mutilate_oh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
rupture 673 2.5% 28.5 16.04sec 10683 10452 0 0 0 0.0% 4.9% 0.0% 0.0% 217 1093 2255 26.8% 0.0% 95.8%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.50 28.50 216.80 216.80 1.0220 2.0000 304455
Direct Results Count Pct Average Min Max Total Damage
hit 27.1 95.14% 0.00 0 0 0
dodge 1.4 4.86% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.7 73.18% 1092.73 572 1765 173364
crit 58.1 26.82% 2254.54 1178 3636 131091

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.030000
  • base_td:202.54
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 1.0 9.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0051 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds
venomous_wound 2734 10.0% 142.8 3.14sec 8665 0 8089 12495 16875 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.77 142.77 0.00 0.00 0.0000 0.0000 1237037
Direct Results Count Pct Average Min Max Total Damage
hit 124.1 86.93% 8088.81 7280 10923 1003913
crit 18.7 13.07% 12494.89 11247 16875 233123

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.176000
  • base_dd_min:675.14
  • base_dd_max:675.14

Resources

Resource Usage Type Res% DPR RPE
Rogue_Assassination_T11_372
backstab energy 38.1% 243.7 60
envenom energy 18.2% 808.9 35
garrote energy 1.4% 421.4 45
mutilate energy 36.1% 307.4 55
rupture energy 5.9% 427.3 25
slice_and_dice energy 0.2% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 45.3 226.5 5.0 0.0%
cold_blood energy 4.1 102.0 24.8 0.7%
energy_refund energy 192.7 624.3 3.2 2.2%
energy_regen energy 1809.9 5366.6 3.0 0.6%
murderous_intent energy 73.0 2189.6 30.0 0.0%
overkill energy 299.6 292.7 1.0 2.9%
relentless_strikes energy 71.9 1798.0 25.0 0.0%
venomous_vim energy 142.8 1412.2 9.9 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cold_blood 4.1 0.0 124.7sec 124.7sec 0% 0%

Database details

  • id:
  • cooldown name:buff_cold_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:120.00
  • default_chance:100.00%
deadly_proc 341.4 0.0 1.3sec 1.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
envenom 54.0 9.0 8.3sec 7.1sec 73% 75%

Database details

  • id:
  • cooldown name:buff_envenom
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.5 7.2 38.8sec 23.3sec 39% 40%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.8 45.9sec 31.7sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overkill 3.8 0.0 128.6sec 128.6sec 17% 17%

Database details

  • id:
  • cooldown name:buff_overkill
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 1.0 345.4 316.9sec 1.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.7sec 78.7sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
slice_and_dice 1.0 59.9 9.1sec 7.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:21.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.1 0.7 50.0sec 45.8sec 8% 13%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 2.8 0.0 182.3sec 182.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
vendetta 4.3 0.0 120.3sec 120.3sec 27% 100%

Database details

  • id:
  • cooldown name:buff_vendetta
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.5%
poisoned 100.0%

Procs

Count Interval
combo_points 379.8 2.2sec
combo_points_wasted 17.6 24.4sec
deadly_poisons 346.4 1.3sec
ruthlessness 52.8 8.5sec
seal_fate 99.4 4.5sec
venomous_wounds 142.8 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.43%
σ of the average dps 6.0382
2 * σ / μ 0.0443%
95% Confidence Intervall ( μ ± 2σ ) ( 27268.38 - 27292.53 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27262.34 - 27298.57 )
Sample Data
σ 603.8177
Minimum 25234.47
Maximum 29443.96
Spread ( max - min ) 4209.49
Range ( max - min ) / 2 2104.75
Range% 7.72
10th Percentile 26536.34
90th Percentile 28095.60
( 90th Percentile - 10th Percentile ) 1559.26
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1959
0.1 scale factor error with delta=300 3240
0.05 scale factor error with delta=300 12963
0.01 scale factor error with delta=300 324085
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 garrote
A slice_and_dice,if=buff.slice_and_dice.down
B rupture,if=!ticking&time<6
C vendetta
D rupture,if=!ticking&buff.slice_and_dice.remains>6
E cold_blood,sync=envenom
F envenom,if=combo_points>=4&buff.envenom.down
G envenom,if=combo_points>=4&energy>90
H envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
I backstab,if=combo_points<5&target.health_pct<35
J mutilate,if=combo_points<4&target.health_pct>=35
K vanish,if=time>30&energy>50

Sample Sequence

01245689ACJBJEFJJGJJGJJDJJFJJFK9JJFJDJFJFJGJDJJFJJFJJJFJDJFJJFJDJJJFJJFJDJJFCJJEFJDJJFJJFJDJFJJFJDJJFJFJ8DJFJJFJJDDDJFJJFK9JDJJFJFJJFJDJFJCFGJJDJJEFJFJJDJFGGJJFJDDJFJFDJJJFJDJJFJJFJDJJFJJFDII8FIICIFIDIIFIIIFIDIIIEFIIIFK9IDIIFIIIIFGIIIIDIIFIIIFGIIIIFIDIIFIIIFIIDIIFIIIIFIIIFIDIIFIIIFCIDIIFIIIDIIIFIIEFII4IIFIDIIIFIIFIDIIIFI8I

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 13.01% 13.01% 1333
Spell Crit 9.88% 4.88% 874
Spell Haste 16.59% 11.03% 1413
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 15656 11048 190
Melee Hit 11.10% 11.10% 1333
Melee Crit 29.90% 20.89% 874
Melee Haste 11.03% 11.03% 1413
Expertise 6.56 6.56 197
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.76% 17.76% 1749

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 3
Lethality 3
Ruthlessness 3
Quickening 2
Puncturing Wounds 3
Blackjack 0
Deadly Brew 1
Cold Blood 1
Vile Poisons 3
Deadened Nerves 0
Seal Fate 2
Murderous Intent 2
Overkill 1
Master Poisoner 1
Improved Expose Armor 0
Cut to the Chase 3
Venomous Wounds 2
Vendetta 1
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 2
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 3
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Assassination_T11_372
origin="http://chardev.org/?profile=36311"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
glyphs=expose_armor/mutilate/backstab/rupture
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/garrote
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/rupture,if=!ticking&time<6
actions+=/vendetta
actions+=/rupture,if=!ticking&buff.slice_and_dice.remains>6
actions+=/cold_blood,sync=envenom
actions+=/envenom,if=combo_points>=4&buff.envenom.down
actions+=/envenom,if=combo_points>=4&energy>90
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/backstab,if=combo_points<5&target.health_pct<35
actions+=/mutilate,if=combo_points<4&target.health_pct>=35
actions+=/vanish,if=time>30&energy>50
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=197
# gear_hit_rating=1333
# gear_crit_rating=874
# gear_haste_rating=1413
# gear_mastery_rating=1749
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Combat_T11_372 : 26790dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26790.3 11.49 / 0.04% 1009.1 26.5 26.4 energy 24.68% 45.7
Origin http://chardev.org/?profile=55921
Talents http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
Glyphs
  • expose_armor
  • slice_and_dice
  • sinister_strike
  • adrenaline_rush

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:56154|30117|23147|10570|8084|4555|3976&chds=0,112308&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++56154++killing_spree,C79C6E,0,0,15|t++30117++eviscerate,C79C6E,1,0,15|t++23147++rupture,C55D54,2,0,15|t++10570++sinister_strike,C79C6E,3,0,15|t++8084++revealing_strike,C79C6E,4,0,15|t++4555++melee_main_hand,C79C6E,5,0,15|t++3976++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Combat_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:19,17,15,14,9,8,8,4,3,2,1&chds=0,100&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,336600,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|melee_main_hand|melee_off_hand|instant_poison|main_gauche|deadly_poison|eviscerate|rupture|revealing_strike|killing_spree_mh|killing_spree_oh&chtt=Rogue_Combat_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o82wrou0yvqoomkjjjkkllqrppruy012466655664yspolifcaYWVUTTTTTTTSTTTTTTUUUUUUTTTUUUUUUUTTTTTTTTTTSSSSSSSTTTUUVVWXYZacdefghiijjkkjjjiihhgfecbaZYYXWVVUUTTTSSSSSSSSSSSTTTTTTTTTTTTTSSSSSSSTUUUUUVVWWWWWXXYZaabcdefgghiijjkkkjjjihgfecbaZYXWVVUUUTTTTTTTTTTTUUUUUUUUUUUUUTTTTTTTSSSSSSSSSTTTTUUVVWWXYZaabcdefgghhiiiiihhhggfeedddcbbaaZYYXWWVVVUUTTTTTTTSSSSSSSSSSSSSSSSSSSSSSSTUVVWWXXYZZZZaabccddeffghhijkkllllllkkjihgfedcaZYXXWVVUUTTTTTTSSSSSSSSSSTTTSSSSSSSSSSTSSSST&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Rogue_Combat_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suvxyz01234556666787654210zyxwvuuuuuuutssrrrrqqponmlkkjihgggfffffffffgggghhiiijjjjjkkkkkjjjjiihhhgggffffffggghijklmnoppqrrsstssssrrqpponmllkjiihhggggggggghhhhiiiiiiiiiihhhhhgggggggggghhhijjklmmnnoopppppqqqqqqpppppoooonnnmmmmmllllkkkkjjjjiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiijjkkllmnnooppqqqqrrqqqqppoonnmmllkkjjjiiiiiiiiiiiiihhhhhhhhggggffffffgggghhhiiijkklmmnnooppqqqqqrrrrrrrrrrrqqqqqqppppooonnnmmllkkjjiiihhhggggffffffffffgggggggghhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26790|max=42315&chxp=1,1,63,100&chtt=Rogue_Combat_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,6,9,18,8,30,41,51,81,89,136,176,197,273,319,374,396,445,555,536,552,616,568,572,543,465,488,408,340,313,277,228,201,178,124,93,75,64,46,38,19,16,8,7,1,5,4,3,3&chds=0,616&chbh=5&chxt=x&chxl=0:|min=24885|avg=26790|max=29004&chxp=0,1,46,100&chtt=Rogue_Combat_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Combat_T11_372 26790
deadly_poison 2159 8.1% 187.4 2.41sec 5212 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148 6134 9480 13.5% 0.0% 98.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
187.42 2.81 148.35 148.35 0.0000 3.0000 976851
Direct Results Count Pct Average Min Max Total Damage
hit 2.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.4 86.54% 6134.28 989 9733 787572
crit 20.0 13.46% 9480.11 1528 15038 189279

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2126 7.9% 31.3 14.33sec 30691 30117 21282 43725 58658 41.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.34 31.34 0.00 0.00 1.0190 0.0000 961771
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 58.08% 21281.74 13135 28475 387313
crit 13.1 41.92% 43724.63 27058 58658 574459

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 3718 13.9% 484.3 0.99sec 3473 0 3249 5019 7747 13.4% 0.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.29 484.29 0.00 0.00 0.0000 0.0000 1681923
Direct Results Count Pct Average Min Max Total Damage
hit 417.5 86.21% 3248.82 2549 5014 1356365
crit 64.9 13.39% 5019.39 3938 7747 325558
miss 1.9 0.40% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
killing_spree 910 3.4% 7.3 63.51sec 56554 56154 0 0 0 0.0% 0.0% 0.0% 0.0% 36 0 0 0.0% 0.0% 4.0%

Stats details: killing_spree

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.28 7.28 36.30 0.00 1.0071 0.5000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:energy
  • tree:combat
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 576 2.1% 36.3 11.34sec 7174 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 5545 11482 27.4% 0.0% 0.0%

Stats details: killing_spree_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.30 0.00 0.00 36.30 0.0000 0.0000 260382
Tick Results Count Pct Average Min Max Total Damage
hit 26.3 72.56% 5545.21 3854 7367 146049
crit 10.0 27.44% 11481.71 7938 15176 114333

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 335 1.2% 36.3 11.34sec 4172 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3228 6685 27.3% 0.0% 0.0%

Stats details: killing_spree_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.30 0.00 0.00 36.30 0.0000 0.0000 151428
Tick Results Count Pct Average Min Max Total Damage
hit 26.4 72.70% 3228.46 2235 4327 85187
crit 9.9 27.30% 6684.67 4604 8913 66241

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 2474 9.2% 178.3 2.53sec 6277 0 4864 10044 15176 27.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.31 178.31 0.00 0.00 0.0000 0.0000 1119246
Direct Results Count Pct Average Min Max Total Damage
hit 129.7 72.72% 4863.96 3854 7367 630739
crit 48.6 27.28% 10044.05 7938 15176 488506

Action details: main_gauche

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 4550 17.0% 361.0 1.26sec 5703 4555 5132 10607 16163 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
360.95 360.95 0.00 0.00 1.2521 0.0000 2058405
Direct Results Count Pct Average Min Max Total Damage
hit 132.9 36.83% 5132.44 4088 7846 682246
crit 98.3 27.24% 10606.54 8422 16163 1042756
glance 86.5 23.96% 3855.07 3066 5885 333403
miss 43.2 11.98% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3974 14.8% 669.1 0.68sec 2687 3976 2419 4999 7617 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
669.12 669.12 0.00 0.00 0.6759 0.0000 1798066
Direct Results Count Pct Average Min Max Total Damage
hit 246.4 36.82% 2419.30 1927 3697 596025
crit 182.2 27.22% 4998.74 3969 7617 910575
glance 160.4 23.98% 1816.76 1445 2773 291467
miss 80.2 11.98% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revealing_strike 684 2.6% 37.5 11.98sec 8251 8084 6395 13203 16836 27.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: revealing_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.48 37.48 0.00 0.00 1.0208 0.0000 309241
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 72.73% 6394.56 5110 8173 174295
crit 10.2 27.27% 13203.35 10527 16836 134946

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reveals a weakness, increasing the effectiveness of the rogue's next finishing move by $s3%.
  • description:An instant strike that causes $m1% of your normal weapon damage and increases the effectiveness of your next offensive finishing move on that target by $s3% for $d. Awards 1 combo point.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 998 3.7% 19.1 23.34sec 23600 23147 0 0 0 0.0% 0.0% 0.0% 0.0% 153 2294 4741 27.2% 0.0% 67.5%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.14 19.14 152.60 152.60 1.0196 2.0000 451671
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 111.1 72.81% 2294.46 1464 3178 254918
crit 41.5 27.19% 4741.19 3015 6546 196753

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
sinister_strike 5197 19.4% 218.8 2.07sec 10747 10570 7434 17709 22617 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
218.80 218.80 0.00 0.00 1.0167 0.0000 2351381
Direct Results Count Pct Average Min Max Total Damage
hit 148.3 67.76% 7434.32 6012 9511 1102149
crit 70.5 32.24% 17708.65 14296 22617 1249232

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:39.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:200.29
  • base_dd_max:200.29
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slice_and_dice 0 0.0% 16.1 28.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.15 16.15 0.00 0.00 1.0187 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.1 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Combat_T11_372
eviscerate energy 9.1% 876.9 35
revealing_strike energy 12.5% 206.3 40
rupture energy 4.0% 944.0 25
sinister_strike energy 71.0% 275.6 39
slice_and_dice energy 3.4% 0.0 25
Resource Gains Type Count energy Average Overflow
adrenaline_rush energy 417.2 1456.3 3.5 6.9%
combat_potency energy 153.3 2237.6 14.6 2.7%
energy_regen energy 1809.9 6768.7 3.7 1.5%
relentless_strikes energy 59.3 1481.4 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.3 0.0 88.4sec 88.4sec 23% 34%

Database details

  • id:
  • cooldown name:buff_adrenaline_rush
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
berserking 3.0 0.0 180.4sec 180.4sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 172.9 0.0 2.6sec 2.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
killing_spree 7.3 0.0 63.5sec 63.5sec 3% 39%

Database details

  • id:
  • cooldown name:buff_killing_spree
  • tooltip:(null)
  • max_stacks:1
  • duration:2.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 13.4 13.7 33.7sec 16.2sec 51% 53%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.7 4.1 45.2sec 30.9sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
poison_doses 2.8 183.9 144.2sec 2.4sec 99% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.4sec 78.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
revealing_strike 37.5 0.0 12.0sec 12.0sec 15% 85%

Database details

  • id:
  • cooldown name:buff_revealing_strike
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
slice_and_dice 1.3 14.8 220.5sec 28.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:40.50
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 7.8 1.3 52.7sec 44.6sec 14% 20%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
deep_insight 41.2%
energy_cap 1.9%
moderate_insight 20.1%
shallow_insight 20.5%

Procs

Count Interval
combo_points 300.1 1.8sec
combo_points_wasted 1.4 117.2sec
deadly_poisons 187.4 2.4sec
main_gauche 178.3 2.5sec
sinister_strike_glyph 43.9 10.2sec

Statistics & Data Analysis

DPS
Population
Convergence 69.98%
σ of the average dps 5.7448
2 * σ / μ 0.0429%
95% Confidence Intervall ( μ ± 2σ ) ( 26778.80 - 26801.78 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26773.06 - 26807.53 )
Sample Data
σ 574.4817
Minimum 24884.87
Maximum 29004.46
Spread ( max - min ) 4119.59
Range ( max - min ) / 2 2059.80
Range% 7.69
10th Percentile 26085.10
90th Percentile 27561.80
( 90th Percentile - 10th Percentile ) 1476.71
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1839
0.1 scale factor error with delta=300 2933
0.05 scale factor error with delta=300 11734
0.01 scale factor error with delta=300 293359
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 kick
7 berserking
8 slice_and_dice,if=buff.slice_and_dice.down
9 slice_and_dice,if=buff.slice_and_dice.remains<2
A killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
B adrenaline_rush,if=energy<35
C eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
D rupture,if=!ticking&combo_points=5&target.time_to_die>10
E eviscerate,if=combo_points=5
F revealing_strike,if=combo_points=4&buff.revealing_strike.down
G sinister_strike,if=combo_points<5

Sample Sequence

012457G8GGGFDGGGFEGGAGGFCGG9BGGGGFCGGGFDGGGFEGGGGEGG9GGGFCGGGFDGG9GGGAGGEGGGFCGGFDGGG9GGGGBFDGGGFEGGGFCGGFCGGGGCGGG9GAGGGDGGGGFEGGGFDG9GGGG7FEGGGFDG9BGGGGFCGGGGFCGGGFCG9GGGAGFDGGFEGG9GGGGFDGGGGFEGG9GGGFDGGGFEGAGGGDGBGG9GGGEGGGGFEGGGFDGGGFCGGG9GGGGFDGGGGFAEGGGF9GGGGDGGG7GFCGGGGFDGGBGGEGGGGFCGG9GGGGCGGGGFADGGGGGEGG9GGGGDGGGFCGG9GGGFDGGGFEGAGF9GBGGGGCGGGFCGGGGFDGGGFEGGGFCGGGG9GGGG4GDGAGGGFEGGGF9GG7G

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 10.60% 10.60% 1086
Spell Crit 10.24% 5.24% 940
Spell Haste 18.83% 13.17% 1687
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20352 14362 190
Melee Hit 9.04% 9.04% 1086
Melee Crit 30.27% 21.26% 940
Melee Haste 13.17% 13.17% 1687
Expertise 26.01 26.01 781
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1057

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 2
Puncturing Wounds 0
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 2
Improved Sinister Strike 3
Precision 3
Improved Slice and Dice 2
Improved Sprint 2
Aggression 3
Improved Kick 0
Lightning Reflexes 3
Revealing Strike 1
Reinforced Leather 0
Improved Gouge 0
Combat Potency 3
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 1
Savage Combat 2
Bandit's Guile 3
Restless Blades 2
Killing Spree 1
Subtlety Rank
Nightstalker 0
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 0
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Combat_T11_372
origin="http://chardev.org/?profile=55921"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
glyphs=expose_armor/slice_and_dice/sinister_strike/adrenaline_rush
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/kick
actions+=/berserking
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
actions+=/rupture,if=!ticking&combo_points=5&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5
actions+=/revealing_strike,if=combo_points=4&buff.revealing_strike.down
actions+=/sinister_strike,if=combo_points<5
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=1086
# gear_crit_rating=940
# gear_haste_rating=1687
# gear_mastery_rating=1057
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Subtlety_T11_372 : 26689dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26688.6 9.25 / 0.03% 1202.4 22.2 22.1 energy 34.47% 46.2
Origin http://chardev.org/?profile=36352
Talents http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
Glyphs
  • expose_armor
  • backstab
  • shadow_dance
  • slice_and_dice

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:116930|34057|26121|25226|4693|2345&chds=0,233860&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++116930++rupture,C55D54,0,0,15|t++34057++ambush,C79C6E,1,0,15|t++26121++eviscerate,C79C6E,2,0,15|t++25226++backstab,C79C6E,3,0,15|t++4693++melee_main_hand,C79C6E,4,0,15|t++2345++melee_off_hand,C79C6E,5,0,15&chtt=Rogue_Subtlety_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:31,18,11,11,9,8,7,5&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,C55D54&chl=backstab|melee_main_hand|ambush|eviscerate|melee_off_hand|instant_poison|deadly_poison|rupture&chtt=Rogue_Subtlety_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:k70mtmYdWUUcifnoroejadbfbgrtqzzrlekhgfhptjYdaYZXbfeXeXbmkccfXefnuuqjcZYSSWbXdaahkfcgafedccfhfZdacggbbeZdacaeehdadadeeZdcbdccbhkrusngZWTSVWZZbbcfdebcbdcdcacbccebefeecddgegeegfedebededeefgfhinqsqnhcZWVWYYaabccdcdcdccccddededdddddecdcecdccccdcedfefeefefgjlopomieaXWXXZZbcdddededddccccbcbccdccccccdcdcddddcdcdccccccdegilnoonkhdaZYYZabcdddddcdcccddcdcdcdcdccdcdcdcdddeeffffgghhhgghijkmmljgdaYXXXYZbccddeeeeeeeeeeefeeeeeedddddddddcdccccccdddcdddfhjkmmljgdbZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=86&chtt=Rogue_Subtlety_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:85653445543231zzwvvuutttstrqooooooqpqqqqqonmkkjjiiiigffdeeffffggghiihiiiiijjjiihhghgggffffffeefeeddddccbcccccccdcdccbbccdeffggggghhhhhhijjjjjihggffffeeeddddccccccccccccdddeeeefffffffffgghhiiiiiiiiiiijjjjjihhggfffffffffffffffffgggggggfffffeeeeedeeefgghhhiiiiiiiijjjjjiihggfeeedddcccccccccbbbbbbbcccccccccccccccdeffghhhiiiijjkkllllkkjiihggfffeedddccccccccccdddeeefffggghhhiiijjjkkkkkkkllllllllkkjjjiiiiiiiiiiiiiiiiiiiiiiihhhgggfffeeddddddeeffgghhhhhiijkk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26689|max=47497&chxp=1,1,56,100&chtt=Rogue_Subtlety_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,10,9,16,24,26,42,53,68,82,141,187,192,266,257,385,412,448,482,484,525,538,546,517,554,476,485,460,406,332,287,283,214,173,155,112,118,64,45,37,25,21,20,9,5,3,1,0,1&chds=0,554&chbh=5&chxt=x&chxl=0:|min=25181|avg=26689|max=28401&chxp=0,1,47,100&chtt=Rogue_Subtlety_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Subtlety_T11_372 26689
ambush 3011 11.3% 39.2 11.35sec 34793 34057 16711 35613 57105 95.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.15 39.15 0.00 0.00 1.0216 0.0000 1362232
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 4.23% 16711.07 13047 24967 27675
crit 37.5 95.71% 35613.45 26877 57105 1334557
dodge 0.0 0.06% 0.00 0 0 0

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target (${$m2*1.447}% plus ${$m1*$m2/100*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:367.95
  • base_dd_max:367.95
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
backstab 8199 30.7% 142.9 3.08sec 25954 25226 13169 31428 46055 70.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.93 142.93 0.00 0.00 1.0289 0.0000 3709537
Direct Results Count Pct Average Min Max Total Damage
hit 42.7 29.88% 13168.84 11839 19367 562449
crit 100.1 70.06% 31428.29 28152 46055 3147088
dodge 0.1 0.06% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
deadly_poison 1930 7.2% 167.3 2.69sec 5220 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147 5490 8484 14.6% 0.0% 97.7%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.25 3.81 147.29 147.29 0.0000 3.0000 873102
Direct Results Count Pct Average Min Max Total Damage
hit 3.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.7 85.37% 5489.87 1079 7345 690336
crit 21.5 14.63% 8483.93 1667 11348 182766

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2951 11.1% 49.8 8.93sec 26800 26121 18039 37143 52612 45.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
49.82 49.82 0.00 0.00 1.0260 0.0000 1335236
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 54.04% 18038.93 15278 25540 485642
crit 22.9 45.91% 37142.83 31472 52612 849594
dodge 0.0 0.05% 0.00 0 0 0

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 2128 8.0% 315.3 1.43sec 3054 0 2935 4534 5846 14.1% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
315.30 315.30 0.00 0.00 0.0000 0.0000 962996
Direct Results Count Pct Average Min Max Total Damage
hit 259.4 82.28% 2934.71 2781 3784 761361
crit 44.5 14.10% 4534.10 4296 5846 201635
miss 11.4 3.61% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4689 17.6% 510.3 0.89sec 4157 4693 3555 7384 10605 35.2% 15.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
510.35 510.35 0.00 0.00 0.8859 0.0000 2121679
Direct Results Count Pct Average Min Max Total Damage
hit 131.4 25.75% 3554.78 3091 5148 467168
crit 179.6 35.19% 7384.08 6368 10605 1326211
glance 122.6 24.01% 2678.88 2319 3861 328300
dodge 0.3 0.06% 0.00 0 0 0
miss 76.5 14.99% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2344 8.8% 655.7 0.69sec 1618 2345 1383 2872 4125 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
655.67 655.67 0.00 0.00 0.6897 0.0000 1060612
Direct Results Count Pct Average Min Max Total Damage
hit 168.8 25.74% 1382.84 1203 2003 233365
crit 231.0 35.23% 2872.13 2477 4125 663371
glance 157.3 23.99% 1042.05 902 1502 163876
dodge 0.4 0.06% 0.00 0 0 0
miss 98.3 15.00% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recuperate 0 0.0% 14.9 30.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recuperate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.87 14.87 0.00 0.00 1.0191 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: recuperate

Static Values
  • id:73651
  • school:physical
  • resource:energy
  • tree:combat
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Recovering $w1% of maximum health every $t1 sec.
  • description:Finishing move that consumes combo points on any nearby target to restore $s1% of maximum health every $t1 sec. Lasts longer per combo point: 1 point : 6 seconds 2 points: 12 seconds 3 points: 18 seconds 4 points: 24 seconds 5 points: 30 seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rupture 1437 5.4% 5.5 87.36sec 119049 116930 0 0 0 0.0% 0.1% 0.0% 0.0% 220 2155 4452 35.0% 0.0% 97.1%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 219.62 219.62 1.0181 2.0000 650174
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 99.94% 0.00 0 0 0
dodge 0.0 0.06% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 142.7 64.95% 2155.48 2058 2750 307488
crit 77.0 35.05% 4452.16 4238 5665 342686

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 17.3 26.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.32 17.32 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 17.3 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Subtlety_T11_372
ambush energy 15.6% 869.8 40
backstab energy 56.9% 648.9 40
eviscerate energy 17.4% 765.7 35
recuperate energy 4.4% 0.0 30
rupture energy 1.4% 4762.0 25
slice_and_dice energy 4.3% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 100.1 500.7 5.0 0.0%
energy_refund energy 175.6 4.1 0.0 0.0%
energy_regen energy 1809.9 5574.6 3.1 0.0%
recuperate energy 143.2 1718.2 12.0 0.0%
relentless_strikes energy 87.5 2186.3 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 142.8 0.0 3.1sec 3.1sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
find_weakness 11.7 27.4 40.0sec 11.4sec 37% 100%

Database details

  • id:
  • cooldown name:buff_find_weakness
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.0 8.1 37.2sec 21.6sec 41% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.7 46.7sec 32.5sec 29% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.6 0.0 83.3sec 83.3sec 7% 100%

Database details

  • id:
  • cooldown name:buff_master_of_subtlety
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 3.8 157.4 112.4sec 2.8sec 98% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.8sec 78.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
recuperate 6.7 8.2 69.5sec 31.0sec 95% 95%

Database details

  • id:
  • cooldown name:buff_recuperate
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_dance 7.6 0.0 63.2sec 63.2sec 13% 13%

Database details

  • id:
  • cooldown name:buff_shadow_dance
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
shadowstep 7.6 0.0 63.6sec 63.6sec 0% 100%

Database details

  • id:
  • cooldown name:buff_shadowstep
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 8.6 8.8 53.4sec 26.8sec 97% 99%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.9 1.1 46.8sec 41.3sec 11% 17%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.7sec 423.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 4.6 0.0 98.6sec 98.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points 486.3 1.2sec
combo_points_wasted 46.6 13.7sec
deadly_poisons 167.3 2.7sec
hat_donor 303.5 1.5sec
honor_among_thieves 205.3 2.2sec
serrated_blades 49.8 8.9sec

Statistics & Data Analysis

DPS
Population
Convergence 71.80%
σ of the average dps 4.6253
2 * σ / μ 0.0347%
95% Confidence Intervall ( μ ± 2σ ) ( 26679.37 - 26697.87 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26674.75 - 26702.50 )
Sample Data
σ 462.5269
Minimum 25180.94
Maximum 28401.48
Spread ( max - min ) 3220.54
Range ( max - min ) / 2 1610.27
Range% 6.03
10th Percentile 26118.86
90th Percentile 27307.45
( 90th Percentile - 10th Percentile ) 1188.59
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1201
0.1 scale factor error with delta=300 1901
0.05 scale factor error with delta=300 7606
0.01 scale factor error with delta=300 190160
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 pool_energy,for_next=1
A shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
B pool_energy,for_next=1
C vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
D shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
E premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
F ambush,if=combo_points<=4
G preparation,if=cooldown.vanish.remains>60
H slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
I rupture,if=combo_points=5&!ticking
J recuperate,if=combo_points=5&remains<3
K eviscerate,if=combo_points=5&dot.rupture.remains>1
L backstab,if=combo_points<3&energy>60
M backstab,if=cooldown.honor_among_thieves.remains>1.75
N backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0

Sample Sequence

0124568DEFHAFFIFFJFFKLNKLLMKLMHCEFGKLLMJLLKCFMKMMKLLHLLMKM99999999ADFJEFKFFKLMHLLKLMMKLMJLLKLMMHMMKLLKLMMJ99999ADEFKFFHFFKLMKMMKLLMJLMHMMILMMKLM8KLLJLL9999ADFHEFIFFKMMKLLKLLHCEFJLMKLMKLMMKLMHLLJLL999ADFIEFKFFKLMHLMKLMMJLMKMMKLMMHLMKMMJLL999KADEFKFFHFFKLMKLLJLMMKMMHLLKLMM8KLMKLMMHBBBM9999999J99ADEFIFFKFKMMKLMMHMMKCEFGJLLKLMMKBBCFHLLMKLMJLL999K99ADEFKFFHFKLLKLMMJMMKLMMHLMKLLKLMMKLMJMM999H9999ADEFIF4FKFFKLMKMMHLMMJ8M

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 8637 6944 4879
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.38% 9.38% 961
Spell Crit 11.43% 6.43% 1152
Spell Haste 20.59% 14.84% 1901
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20143 14341 190
Melee Hit 8.00% 8.00% 961
Melee Crit 37.73% 27.51% 1152
Melee Haste 14.84% 14.84% 1901
Expertise 25.78 25.78 774
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 29.69% 23.83% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.50% 11.50% 628

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 0
Puncturing Wounds 3
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 0
Improved Ambush 3
Relentless Strikes 3
Elusiveness 1
Waylay 0
Opportunity 3
Initiative 2
Energetic Recovery 3
Find Weakness 2
Hemorrhage 1
Honor Among Thieves 3
Premeditation 1
Enveloping Shadows 0
Cheat Death 0
Preparation 1
Sanguinary Vein 2
Slaughter from the Shadows 3
Serrated Blades 2
Shadow Dance 1

Profile

#!./simc

rogue=Rogue_Subtlety_T11_372
origin="http://chardev.org/?profile=36352"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
glyphs=expose_armor/backstab/shadow_dance/slice_and_dice
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/pool_energy,for_next=1
actions+=/shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
actions+=/pool_energy,for_next=1
actions+=/vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
actions+=/shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=4
actions+=/preparation,if=cooldown.vanish.remains>60
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&!ticking
actions+=/recuperate,if=combo_points=5&remains<3
actions+=/eviscerate,if=combo_points=5&dot.rupture.remains>1
actions+=/backstab,if=combo_points<3&energy>60
actions+=/backstab,if=cooldown.honor_among_thieves.remains>1.75
actions+=/backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4879
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=774
# gear_hit_rating=961
# gear_crit_rating=1152
# gear_haste_rating=1901
# gear_mastery_rating=628
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# These values represent the avg HAT donor interval of the raid. # A negative value will make the Rogue use a programmed default interval. # A zero value will disable virtual HAT procs and assume a real raid is being simulated. virtual_hat_interval=-1 # A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Shaman_Elemental_T11_372 : 26661dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26660.8 11.68 / 0.04% 22.0 1211.3 1225.1 mana 0.00% 47.0
Origin http://chardev.org/?profile=14385
Talents http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
Glyphs
  • chain_lightning
  • thunder
  • healing_stream_totem
  • thunderstorm
  • astral_recall
  • renewed_life
  • flame_shock
  • lightning_bolt
  • lava_burst

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:39842|31162|13582|7500|5087|3556|624|126&chds=0,79683&chco=C41F3B,C41F3B,336600,336600,C41F3B,C41F3B,C79C6E,C41F3B&chm=t++39842++flame_shock,C41F3B,0,0,15|t++31162++lava_burst,C41F3B,1,0,15|t++13582++lightning_bolt,336600,2,0,15|t++7500++earth_shock,336600,3,0,15|t++5087++fire_nova,C41F3B,4,0,15|t++3556++fire_melee,C41F3B,5,0,15|t++624++earth_melee,C79C6E,6,0,15|t++126++fire_shield,C41F3B,7,0,15&chtt=Shaman_Elemental_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x340&cht=p&chf=bg,s,333333&chd=t:35,19,10,9,7,7,6,2,2,1,1,0,0,0&chds=0,100&chco=336600,C41F3B,336600,336600,C41F3B,C41F3B,C41F3B,336600,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C41F3B&chl=lightning_bolt|lava_burst|lightning_bolt_overload|fulmination|flame_shock|searing_totem|lava_burst_overload|earth_shock|fire_melee|fire_nova|earth_melee|fire_blast|darkmoon_card_volcano|fire_shield&chtt=Shaman_Elemental_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:q32zyyyyz01223344556544544444444444445555555555555555566667777666666655555555554444555555555555556666677777776666666655555555554444444444455555566667777877777766666555555555555555555444444445555666677777776666655555555555555555555555555555666666666666666666666555555555555555555555555556666666666666666666665555555555555555555555556666666666666666666666666665555555544444445555555666666777666666666555555555555555555555555555555555555666666666655555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117081&chtt=Shaman_Elemental_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwy1122222464577865421zywuutssrqqqppppqponmnmmmmnmmllmllmlllmnnonnonnnnnopoopppponnnnnnnoonnnmmmmmmmllmmmmmmmlkkkkkjjiihhhhgggfffffffgghijklmnoppqqqrrrrrrrrqpoonmllkkjjjiihhgggfgggghhhiiiiijjjkkkkllkkjjiiihhhhhhiiiijjkkllmnnnooooooooonnmmlllkkkkkjjjjiihhhhhhhhgggggfffffggggghhhhhhhiijjkkkllmmnnnnnnnnnnnmmllkjjiihhhhhhgghhhhhiiiiijjjjjjjjjjjjjiiiiiiiiiiihhhhiijjjkkllmnnoppqqrrrrrrqqppoonmllkjjihhhgggggggggggggffffffffffffgggghhhhiiijjkkkllllllllllm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26661|max=42479&chxp=1,1,63,100&chtt=Shaman_Elemental_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,1,1,0,2,4,20,20,30,61,75,113,173,212,262,341,408,471,577,623,685,677,715,694,599,626,493,437,384,327,256,195,147,105,84,55,44,25,20,18,7,3,2,2,1,1,1,0,1&chds=0,715&chbh=5&chxt=x&chxl=0:|min=24322|avg=26661|max=29354&chxp=0,1,46,100&chtt=Shaman_Elemental_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Elemental_T11_372 26661
darkmoon_card_volcano 70 0.3% 10.1 47.05sec 3133 0 2723 4212 4516 27.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.07 10.07 0.00 0.00 0.0000 0.0000 31559
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.46% 2723.34 2694 2923 19875
crit 2.8 27.54% 4211.84 4162 4516 11684

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
earth_shock 598 2.2% 30.4 14.58sec 8878 7500 6929 14579 20686 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.44 30.44 0.00 0.00 1.1839 0.0000 270239
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.52% 6928.89 5948 9898 157153
crit 7.8 25.48% 14578.99 12432 20686 113086

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
elemental_mastery 0 0.0% 6.6 74.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_mastery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.63 6.63 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.6 100.00% 0.00 0 0 0

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:mana
  • tree:elemental
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Cast time of your next Lightning Bolt, Chain Lightning or Lava Burst spell is reduced by $s1%.
  • description:When activated, your next Lightning Bolt, Chain Lightning or Lava Burst spell becomes an instant cast spell. In addition, your Fire, Frost, and Nature damage is increased by $64701s2%$?s55452[, you take $55452s1% less damage from all sources,][] and you gain $64701s1% spell haste for $64701d.
flame_shock 1835 6.9% 17.7 26.24sec 46767 39842 3855 8090 10516 35.5% 0.0% 0.0% 0.0% 202 2614 5487 35.5% 0.0% 99.6%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.74 17.74 202.20 202.20 1.1738 2.2277 829831
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 64.48% 3854.90 3316 5031 44108
crit 6.3 35.52% 8089.78 6930 10516 50981
Tick Results Count Pct Average Min Max Total Damage
hit 130.4 64.51% 2614.13 2226 3429 340976
crit 71.8 35.49% 5486.97 4653 7167 393766

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:9
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 2367 8.9% 30.4 14.58sec 35176 0 27486 57719 87855 25.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.44 30.44 0.00 0.00 0.0000 0.0000 1070676
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.56% 27485.93 16522 42036 623804
crit 7.7 25.44% 57719.03 34530 87855 446872

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
lava_burst 5109 19.2% 61.6 7.38sec 37517 31162 0 37616 54380 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.59 61.43 0.00 0.00 1.2039 0.0000 2310692
Direct Results Count Pct Average Min Max Total Damage
crit 61.4 100.00% 37615.84 32364 54380 2310692

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.828000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_burst_overload 1517 5.7% 25.3 17.59sec 27063 0 12303 27174 37607 99.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.35 25.28 0.00 0.00 0.0000 0.0000 685949
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 0.24% 12303.32 11086 15411 753
crit 25.2 99.76% 27173.62 22381 37607 685196

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.622000
  • base_dd_min:1047.17
  • base_dd_max:1335.47
lightning_bolt 9403 35.3% 219.9 2.04sec 19339 13582 15127 31881 46051 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
219.90 219.18 0.00 0.00 1.4239 0.0000 4252542
Direct Results Count Pct Average Min Max Total Damage
hit 163.2 74.48% 15127.29 12808 22034 2469479
crit 55.9 25.52% 31880.77 26769 46051 1783063

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.914000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_bolt_overload 2786 10.5% 90.3 4.93sec 13955 0 10914 23008 33307 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.29 90.00 0.00 0.00 0.0000 0.0000 1260049
Direct Results Count Pct Average Min Max Total Damage
hit 67.0 74.48% 10913.52 9264 15936 731502
crit 23.0 25.52% 23008.41 19361 33307 528547

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.686000
  • base_dd_min:539.17
  • base_dd_max:615.99
searing_totem 1820 6.8% 6.0 60.35sec 138347 137581 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3189 6705 25.4% 0.0% 71.3%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 201.64 201.64 1.0056 1.6000 823300
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.4 74.57% 3188.97 2741 4281 479524
crit 51.3 25.43% 6704.61 5729 8947 343777

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - fire_elemental 3690
fire_blast 432 11.7% 12.0 9.86sec 4399 0 4270 8549 9333 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 52794
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.98% 4270.05 3822 4667 49691
crit 0.4 3.02% 8549.31 7645 9333 3103

Action details: fire_blast

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:302.1
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:276.00
  • base_dd_max:321.00
fire_melee 2132 57.8% 23.0 4.93sec 11315 3556 11978 42051 45890 0.2% 0.0% 24.2% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 3.1818 0.0000 260256
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 75.64% 11977.72 10699 13111 208381
crit 0.0 0.20% 42051.21 37447 45890 1960
glance 5.6 24.16% 8984.05 8024 9834 49915

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.135000
  • base_dd_min:427.00
  • base_dd_max:460.00
fire_nova 1000 27.1% 12.0 9.86sec 10173 5087 9880 19775 21608 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 2.0000 0.0000 122079
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 97.03% 9879.62 8836 10804 115037
crit 0.4 2.97% 19774.90 17672 21608 7042

Action details: fire_nova

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:233.8
  • cooldown:7.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:583.00
  • base_dd_max:663.00
fire_shield 126 3.4% 40.9 3.00sec 377 126 366 731 830 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.92 40.92 0.00 0.00 3.0000 0.0000 15439
Direct Results Count Pct Average Min Max Total Damage
hit 39.7 97.01% 366.41 0 415 14544
crit 1.2 2.99% 731.40 0 830 895

Action details: fire_shield

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.032000
  • base_dd_min:89.00
  • base_dd_max:89.00
pet - earth_elemental 586
earth_melee 586 100.0% 58.0 2.00sec 1248 624 1287 2574 2660 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 2.0000 0.0000 72374
Direct Results Count Pct Average Min Max Total Damage
hit 42.4 73.03% 1286.78 1144 1330 54503
crit 1.7 2.97% 2574.37 2288 2660 4434
glance 13.9 24.00% 965.17 858 997 13437

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Elemental_T11_372
bloodlust mana 0.0% 0.0 1
earth_elemental_totem mana 1.0% 0.0 5623
earth_shock mana 16.8% 2.9 3017
fire_elemental_totem mana 1.0% 0.0 5388
flame_shock mana 9.7% 15.6 2989
lava_burst mana 20.4% 20.6 1818
lightning_bolt mana 40.5% 19.1 1010
searing_totem mana 1.3% 118.1 1171
pet - fire_elemental
fire_blast mana 56.4% 14.6 302
fire_nova mana 43.6% 43.7 233
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 26922.7 14.9 8.8%
flask mana 1.0 5700.0 5700.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 106835.0 106835.0 0.0%
mp5_regen mana 1809.9 96949.9 53.6 8.5%
replenishment mana 1809.9 51129.1 28.3 8.1%
rolling_thunder mana 185.6 372027.7 2004.9 18.6%
pet - fire_elemental mana
initial_mana none 1.0 47417.1 47417.1 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.1sec 47.1sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
elemental_focus 85.3 54.2 5.3sec 3.2sec 68% 68%

Database details

  • id:16246
  • cooldown name:buff_elemental_focus
  • tooltip:Your next $n damage or healing spells have their mana cost reduced by $s1%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 6.6 0.0 74.1sec 74.1sec 22% 24%

Database details

  • id:64701
  • cooldown name:buff_elemental_mastery
  • tooltip:Fire, Frost, and Nature damage increased by $s2%. Casting speed of all spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.6sec 48.6sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 113.1sec 113.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 1.0 0.0 339.0sec 339.0sec 4% 4%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
fire_elemental-casting 1.0 51.9 0.0sec 2.3sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:9
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
fulmination_4 2.9 97.2sec
fulmination_5 2.6 101.4sec
fulmination_6 24.9 17.8sec
lava_surge 40.5 11.0sec
rolling_thunder 185.6 2.4sec
wasted_lightning_shield 8.7 44.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.63%
σ of the average dps 5.8416
2 * σ / μ 0.0438%
95% Confidence Intervall ( μ ± 2σ ) ( 26649.08 - 26672.45 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26643.24 - 26678.29 )
Sample Data
σ 584.1589
Minimum 24322.27
Maximum 29353.92
Spread ( max - min ) 5031.64
Range ( max - min ) / 2 2515.82
Range% 9.44
10th Percentile 25942.32
90th Percentile 27431.59
( 90th Percentile - 10th Percentile ) 1489.27
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1920
0.1 scale factor error with delta=300 3033
0.05 scale factor error with delta=300 12133
0.01 scale factor error with delta=300 303325
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 flametongue_weapon,weapon=main
3 lightning_shield
4 mana_spring_totem
5 wrath_of_air_totem
6 snapshot_stats
7 volcanic_potion,if=!in_combat|buff.bloodlust.react
8 wind_shear
9 bloodlust,health_percentage<=25
A bloodlust,if=target.time_to_die<=60
B berserking
C elemental_mastery
D unleash_elements,moving=1
E flame_shock,if=!ticking|ticks_remain<3
F lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
G earth_shock,if=buff.lightning_shield.stack=9
H earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
I fire_elemental_totem
J earth_elemental_totem
K searing_totem
L spiritwalkers_grace,moving=1
M chain_lightning,if=target.adds>2
N lightning_bolt
O thunderstorm

Sample Sequence

01237ABCEFIJNNFNNNNFNNNGNNNNFNFENNFNGNNNNNFNNNGNNFNNENNNFGNNNFNNNCGNNFNENNNNGFNNNNGNFNNNNENFNNNNNGFNNNNNNFEKNNNFGNNNNNCFNNNHNNFNENNNNGFNNNFNNNNFGNNNBENFNFKNNNGNNFNNNFNENNNGFNNCNNFNNNNNHNFNNENFNNFGFNNKNFNNGNNNEFNNNNGFNFNNNFNNHNNNEFNCNNGNFNNNNNNKFGNNNENFNNNNNNFNFNNHNFNENNNNFNNNGNNFNNBFGNCKNNENNFNGNNNNNFNNGFNNNNENFNNGFNNNNFNFGFNNENNNFKNNGNFNNFNCNHNNNNEFNNNGNNNFNNNNNHFNNEFNNNNFNNGFKNNNNNEFNNNNNNFGNCNNNNNFGNFNNENNNFNGNNNBN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 736 152 20
Agility 683 102 20
Stamina 7631 6009 5861
Intellect 6097 5314 4926
Spirit 983 983 826
Health 143601 120963 0
Mana 113885 102860 0
Spell Power 10276 7511 2207
Spell Hit 17.03% 17.03% 919
Spell Crit 21.32% 15.11% 309
Spell Haste 19.90% 14.19% 1817
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 2436 466 0
Melee Hit 7.65% 7.65% 919
Melee Crit 14.75% 7.96% 309
Melee Haste 14.19% 14.19% 1817
Expertise 0.00 0.00 0
Armor 19472 15396 15396
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.92% 2.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 18.23% 18.23% 1834

Gear

Encoded
head headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
tabard empty

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 3
Call of Flame 2
Elemental Warding 0
Reverberation 2
Elemental Precision 3
Rolling Thunder 2
Elemental Focus 1
Elemental Reach 2
Elemental Oath 2
Lava Flows 3
Fulmination 1
Elemental Mastery 1
Earth's Grasp 0
Totemic Wrath 1
Feedback 3
Lava Surge 2
Earthquake 1
Enhancement Rank
Elemental Weapons 2
Focused Strikes 0
Improved Shields 3
Elemental Devastation 0
Flurry 0
Ancestral Swiftness 2
Totemic Reach 2
Toughness 0
Stormstrike 0
Static Shock 0
Frozen Power 0
Improved Fire Nova 0
Searing Flames 0
Earthen Power 0
Shamanistic Rage 0
Unleashed Rage 0
Maelstrom Weapon 0
Improved Lava Lash 0
Feral Spirit 0
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Elemental_T11_372
origin="http://chardev.org/?profile=14385"
level=85
race=troll
role=spell
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
glyphs=chain_lightning/thunder/healing_stream_totem/thunderstorm/astral_recall/renewed_life/flame_shock/lightning_bolt/lava_burst
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/flametongue_weapon,weapon=main
actions+=/lightning_shield
actions+=/mana_spring_totem
actions+=/wrath_of_air_totem
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat|buff.bloodlust.react
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/berserking
actions+=/elemental_mastery
actions+=/unleash_elements,moving=1
actions+=/flame_shock,if=!ticking|ticks_remain<3
actions+=/lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
actions+=/earth_shock,if=buff.lightning_shield.stack=9
actions+=/earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains actions+=/fire_elemental_totem
actions+=/earth_elemental_totem
actions+=/searing_totem
actions+=/spiritwalkers_grace,moving=1
actions+=/chain_lightning,if=target.adds>2
actions+=/lightning_bolt
actions+=/thunderstorm
head=headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders=shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
chest=circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist=lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs=kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet=boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists=chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands=gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5861
# gear_intellect=4926
# gear_spirit=826
# gear_spell_power=2207
# gear_hit_rating=919
# gear_crit_rating=309
# gear_haste_rating=1817
# gear_mastery_rating=1834
# gear_armor=15396
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Shaman_Enh_T11_372 : 26692dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26691.6 10.81 / 0.04% 35.4 753.7 752.1 mana 18.54% 36.8
Origin http://chardev.org/?profile=39863
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:23689|19456|14770|9852|8475|3262|2959|1475|652&chds=0,47378&chco=C41F3B,C41F3B,336600,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23689++lava_lash,C41F3B,0,0,15|t++19456++flame_shock,C41F3B,1,0,15|t++14770++lightning_bolt,336600,2,0,15|t++9852++stormstrike,C79C6E,3,0,15|t++8475++earth_shock,336600,4,0,15|t++3262++wolf_melee,C79C6E,5,0,15|t++2959++melee_main_hand,C79C6E,6,0,15|t++1475++melee_off_hand,C79C6E,7,0,15|t++652++earth_melee,C79C6E,8,0,15&chtt=Shaman_Enh_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:13,11,11,10,10,8,5,5,4,4,4,3,3,3,2,2,1,1&chds=0,100&chco=C41F3B,336600,C79C6E,C79C6E,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,336600,336600,C79C6E,C41F3B,C41F3B,336600,C79C6E,C79C6E,C79C6E&chl=lava_lash|lightning_bolt|melee_main_hand|windfury_mh|searing_totem|flametongue_oh|melee_off_hand|flame_shock|stormstrike_mh|earth_shock|darkmoon_card_hurricane|wolf_melee|searing_flames|unleash_flame|lightning_shield|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7776666555555566667777666777777677776777777666677777766666777776777777777766666777777666677777777777777777666677777776776677776666666666666666777777766677777766677777776666777777777766777777777777777766667777777666777777776777777777666777777776667777766666667777666667777777777777777776677777777667777777777777777776667777777776777777777777777777766777777777766666766666666666666666666666666666777666666677766666666777766666666666666666777666666666666&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=25283&chtt=Shaman_Enh_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y55555454557777655554523223210zyywwvvvvvvvuutsrqqppppppppqqqqqppoooooppqqrrrrrqqpppppppqqqrqqqqqpppppppqqrrrqqpppppppqqqrrsstttssttttuuuvvvvvvvuuttttttttttttssrrqqqqqqqppppoooooonnnnooopppoopppoooooppppppppoooooooooppppppppooooooooopppppppppqqqqrrsstttttttttttuuuuuuuuuuuttttssssssssrrrqqpppppppppppppoooooooooppppppppppooooooppppppppooooooooppppppooooooopppppqqqqqrrrrrsssstttttttttttttttuuuuuuttttssssrrrrrqqqpppppooooooooooooopppoooooopppppooopppppp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26692|max=36603&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,0,2,3,4,5,21,15,37,65,61,115,151,198,272,310,410,463,525,578,564,649,685,658,656,570,501,513,431,342,284,216,195,153,111,77,52,33,19,22,12,6,4,3,1,1,4,1&chds=0,685&chbh=5&chxt=x&chxl=0:|min=24481|avg=26692|max=28945&chxp=0,1,50,100&chtt=Shaman_Enh_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372 26692
darkmoon_card_hurricane 977 3.7% 38.6 11.98sec 11448 0 7954 16385 16385 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.59 38.59 0.00 0.00 0.0000 0.0000 441810
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 58.55% 7953.66 7954 7954 179736
crit 16.0 41.45% 16384.54 16385 16385 262074

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1013 3.8% 40.2 11.13sec 11399 8475 8809 13609 17108 54.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.18 40.18 0.00 0.00 1.3450 0.0000 458047
Direct Results Count Pct Average Min Max Total Damage
hit 18.4 45.78% 8809.15 8337 11073 162056
crit 21.7 54.12% 13609.21 12880 17108 295991
miss 0.0 0.10% 0.00 0 0 0

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1324 5.0% 23.0 19.96sec 26089 19456 6015 9294 12271 19.3% 0.1% 0.0% 0.0% 155 2600 4016 19.3% 0.0% 90.8%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.96 22.96 155.40 155.40 1.3409 2.6439 599043
Direct Results Count Pct Average Min Max Total Damage
hit 18.5 80.60% 6014.70 4647 7942 111313
crit 4.4 19.31% 9293.85 7180 12271 41207
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.4 80.67% 2599.58 1992 3481 325894
crit 30.0 19.33% 4016.11 3078 5377 120630

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 2197 8.2% 339.4 1.33sec 2928 0 2651 4096 5174 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
339.41 339.41 0.00 0.00 0.0000 0.0000 993757
Direct Results Count Pct Average Min Max Total Damage
hit 273.5 80.59% 2651.38 2495 3349 725225
crit 65.6 19.32% 4096.10 3855 5174 268533
miss 0.3 0.10% 0.00 0 0 0

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_lash 3471 13.0% 43.7 10.46sec 35950 23689 24994 51584 63098 41.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.68 43.68 0.00 0.00 1.5176 0.0000 1570402
Direct Results Count Pct Average Min Max Total Damage
hit 25.6 58.64% 24994.13 18292 30630 640222
crit 18.0 41.28% 51583.55 37682 63098 930180
dodge 0.0 0.08% 0.00 0 0 0

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3037 11.4% 69.5 6.47sec 19778 14770 14700 22668 29138 64.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
69.47 69.45 0.00 0.00 1.3391 0.0000 1374022
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 35.91% 14699.93 13799 18860 366574
crit 44.4 63.99% 22667.77 21319 29138 1007448
miss 0.1 0.10% 0.00 0 0 0

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 637 2.4% 41.9 10.84sec 6878 0 5462 8419 10738 52.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.87 41.87 0.00 0.00 0.0000 0.0000 288004
Direct Results Count Pct Average Min Max Total Damage
hit 18.9 45.02% 5461.50 5130 6950 102959
crit 22.0 52.50% 8418.51 7926 10738 185045
miss 0.0 0.09% 0.00 0 0 0
none 1.0 2.39% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2895 10.8% 285.3 1.59sec 4590 2959 3498 7212 8743 41.5% 6.8% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
285.33 285.33 0.00 0.00 1.5514 0.0000 1309701
Direct Results Count Pct Average Min Max Total Damage
hit 79.2 27.74% 3498.46 3338 4244 276945
crit 118.3 41.48% 7211.92 6876 8743 853462
glance 68.3 23.94% 2624.64 2503 3183 179294
dodge 0.3 0.09% 0.00 0 0 0
miss 19.3 6.75% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1442 5.4% 284.5 1.59sec 2294 1475 1749 3606 4371 41.4% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
284.48 284.48 0.00 0.00 1.5547 0.0000 652510
Direct Results Count Pct Average Min Max Total Damage
hit 78.9 27.74% 1748.83 1669 2122 138020
crit 117.9 41.43% 3605.56 3438 4371 424920
glance 68.3 23.99% 1312.35 1252 1592 89570
dodge 0.2 0.09% 0.00 0 0 0
miss 19.2 6.75% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 790 3.0% 279.6 1.62sec 1279 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 2723 4210 14.3% 0.0% 80.8%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.62 279.62 121.78 121.78 0.0000 3.0000 357597
Direct Results Count Pct Average Min Max Total Damage
hit 279.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.3 85.66% 2723.06 716 4945 284056
crit 17.5 14.34% 4209.76 1106 7640 73541

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:755.38
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 2603 9.8% 8.1 59.76sec 145642 143393 0 0 0 0.0% 0.0% 0.0% 0.0% 280 3810 5886 19.4% 0.0% 99.0%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.09 8.09 279.89 279.62 1.0157 1.6000 1177618
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 225.5 80.64% 3809.51 3578 4944 859020
crit 54.1 19.36% 5885.68 5528 7639 318598

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 123.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.16 4.16 0.00 0.00 1.2922 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1570 5.9% 47.6 9.50sec 14923 9852 0 0 0 0.0% 0.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.59 47.59 0.00 0.00 1.5147 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 47.2 99.17% 0.00 0 0 0
dodge 0.4 0.83% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 1046 3.9% 47.2 9.58sec 10024 0 6969 14362 17431 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.20 47.20 0.00 0.00 0.0000 0.0000 473080
Direct Results Count Pct Average Min Max Total Damage
hit 27.7 58.68% 6968.76 6655 8462 193000
crit 19.5 41.32% 14361.68 13709 17431 280080

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 524 2.0% 47.2 9.58sec 5025 0 3490 7195 8716 41.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
47.20 47.20 0.00 0.00 0.0000 0.0000 237158
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 58.56% 3489.66 3327 4231 96455
crit 19.6 41.44% 7194.63 6855 8716 140703

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.7 15.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 1.3380 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.7 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 669 2.5% 28.7 15.94sec 10544 0 9549 14751 18328 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 0.0000 0.0000 302845
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.60% 9549.12 9046 11934 221054
crit 5.5 19.30% 14750.78 13975 18328 81790
miss 0.0 0.10% 0.00 0 0 0

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 399 1.5% 28.7 15.94sec 6282 0 4373 9006 10861 41.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.72 28.72 0.00 0.00 0.0000 0.0000 180444
Direct Results Count Pct Average Min Max Total Damage
hit 16.8 58.58% 4372.76 4172 5272 73565
crit 11.9 41.33% 9005.61 8595 10861 106880
dodge 0.0 0.09% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 2629 9.8% 140.9 9.52sec 8439 0 5867 12091 14231 41.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.92 140.92 0.00 0.00 0.0000 0.0000 1189239
Direct Results Count Pct Average Min Max Total Damage
hit 82.5 58.51% 5867.02 5640 6908 483766
crit 58.3 41.40% 12090.54 11617 14231 705473
dodge 0.1 0.08% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 935
wolf_melee 935 100.0% 89.2 4.68sec 4401 3262 4672 9345 10970 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.17 89.17 0.00 0.00 1.3493 0.0000 392448
Direct Results Count Pct Average Min Max Total Damage
hit 67.6 75.77% 4671.64 4448 5485 315655
crit 0.2 0.21% 9345.10 8897 10970 1725
glance 21.4 24.02% 3504.63 3336 4114 75067

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 600
earth_melee 600 100.0% 59.0 2.00sec 1305 652 1346 2691 2815 3.0% 0.0% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 76990
Direct Results Count Pct Average Min Max Total Damage
hit 43.0 72.89% 1345.87 1315 1407 57878
crit 1.8 3.01% 2691.30 2629 2815 4780
glance 14.2 24.06% 1009.36 986 1056 14331
dodge 0.0 0.04% 0.00 0 0 0

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372
bloodlust mana 0.0% 0.0 1523
earth_elemental_totem mana 0.4% 0.0 1406
earth_shock mana 12.4% 10.8 1054
flame_shock mana 6.7% 26.2 996
flametongue_oh mana 35.0% 8.3 351
lava_lash mana 12.0% 38.4 937
lightning_bolt mana 2.3% 173.5 114
searing_totem mana 0.7% 497.5 293
spirit_wolf mana 0.9% 0.0 703
stormstrike mana 26.2% 8.0 1874
unleash_elements mana 3.5% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 20231.7 11.2 31.4%
initial_mana none 1.0 25595.0 25595.0 0.0%
mp5_regen mana 1809.9 74378.0 41.1 29.8%
primal_wisdom mana 323.7 237632.5 734.1 37.3%
replenishment mana 1809.9 7990.8 4.4 31.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 9.2 83.4 49.1sec 4.8sec 92% 92%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 923.2 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 71.9 291.6 6.3sec 1.2sec 86% 86%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.8 7.8 37.5sec 21.9sec 40% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 10.4 5.0 42.0sec 27.7sec 34% 35%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 70.3 280.6 6.5sec 1.3sec 79% 86%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.5 45.7 201.4sec 9.6sec 98% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 339.2sec 339.2sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.7 0.0 15.9sec 15.9sec 33% 78%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.7 0.0 15.9sec 15.9sec 21% 30%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 38.6 12.0sec
flametongue_icd 16.5 26.0sec
maelstrom_weapon 350.8 1.5sec
static_shock 40.9 11.0sec
swings_clipped_mh 5.8 64.2sec
swings_clipped_oh 6.0 61.9sec
wasted_maelstrom_weapon 29.5 16.7sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.55%
σ of the average dps 5.4059
2 * σ / μ 0.0405%
95% Confidence Intervall ( μ ± 2σ ) ( 26680.76 - 26702.38 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26675.35 - 26707.79 )
Sample Data
σ 540.5901
Minimum 24480.72
Maximum 28944.72
Spread ( max - min ) 4463.99
Range ( max - min ) / 2 2232.00
Range% 8.36
10th Percentile 26012.75
90th Percentile 27400.42
( 90th Percentile - 10th Percentile ) 1387.67
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1640
0.1 scale factor error with delta=300 2597
0.05 scale factor error with delta=300 10390
0.01 scale factor error with delta=300 259766
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react

Sample Sequence

012378AEFGIHJLMNHKGQLKHIQGJLHKGILHKGJHLIKHGLHKFLGIJHLKGHLKHIGQJLHQKGLIKQHGJLQKIGHFEKLQKGMIHJLGKQLKIGHLJGKLHIKQGLJQQFGIKLQJGQLHKIQGLKHKGLHIJQQGKLQKIGHLJHFEGKLHIMHJGLQKQIGKLQJQGLIKHLGHKLHIGFJLQKGHLIKHGLHJQIGKLQQKGLHIJLGHKLQFGEIHJLHMGHKLIJGHLKHGIKHLJGQLHIKGLHKFQLGHIJHLGHKLQIJGQLQKGHIJLQGKLHKIGLFHJELGHIKMLQGKQLHIJGQLQKGHIJHLQGKLHIJFGHL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7775 5075 4756
Stamina 7541 5924 5775
Intellect 163 156 20
Spirit 178 178 20
Health 142355 119773 0
Mana 25595 25490 0
Spell Power 11357 5448 0
Spell Hit 16.91% 16.91% 1712
Spell Crit 16.13% 11.12% 1018
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 18248 10603 190
Melee Hit 20.25% 20.25% 1712
Melee Crit 40.53% 27.22% 1018
Melee Haste 5.13% 5.13% 657
Expertise 22.65 22.65 440
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 24.24% 16.86% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.20% 17.20% 1650

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372
origin="http://chardev.org/?profile=39863"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4756
# gear_stamina=5775
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=440
# gear_hit_rating=1712
# gear_crit_rating=1018
# gear_haste_rating=657
# gear_mastery_rating=1650
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Shaman_Enh_T11_372_Caster : 26748dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26747.7 8.70 / 0.03% 29.7 901.1 896.8 mana 6.39% 40.8
Origin http://chardev.org/?profile=39882
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:23420|22735|17625|16689|10043|6995|3199|2438|1443|741&chds=0,46839&chco=C41F3B,C41F3B,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23420++lava_lash,C41F3B,0,0,15|t++22735++flame_shock,C41F3B,1,0,15|t++17625++lightning_bolt,336600,2,0,15|t++16689++lava_burst,C41F3B,3,0,15|t++10043++earth_shock,336600,4,0,15|t++6995++stormstrike,C79C6E,5,0,15|t++3199++wolf_melee,C79C6E,6,0,15|t++2438++melee_main_hand,C79C6E,7,0,15|t++1443++melee_off_hand,C79C6E,8,0,15|t++741++earth_melee,C79C6E,9,0,15&chtt=Shaman_Enh_T11_372_Caster+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x390&cht=p&chf=bg,s,333333&chd=t:14,13,12,7,7,6,6,6,4,4,4,3,3,3,3,2,2,1,1&chds=0,100&chco=336600,C41F3B,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C79C6E,336600,C79C6E,C41F3B,C79C6E,C41F3B,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E&chl=lightning_bolt|lava_lash|searing_totem|lava_burst|melee_main_hand|flametongue_oh|flame_shock|windfury_mh|earth_shock|melee_off_hand|searing_flames|wolf_melee|unleash_flame|lightning_shield|darkmoon_card_hurricane|stormstrike_mh|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372_Caster+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777777665444456345544445565444334566544444445554444555555555554455666654433334444455555555443333445555544333344444444555555554444555666654433344455554444444443444555554433334444455555566554334445556544333344445444445554444444455555444334444555555555554444444555555444444444444444555444444445555544444445555554444444444444445555444444444444444444444444444445555555444444444455555554444444455544444444444444444444444444445555555444344444444444444444444&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=27775&chtt=Shaman_Enh_T11_372_Caster+Mana+Timeline&chts=dddddd,18&chco=2459FF http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y4434344433687755555652333321110zxxwwwvwvvvuttssrqppppopqqqqqpppppppoppqqqqqrrqqqqqqpppqqqrrqqqqqqpppqqqqqrrrqqqqqqqqqqqrrssssssssttttuuuuuuvvvuuuutttttttttsssrrqqqqppppppppppooooooooooopppoppppooooppppppppppppppooooppppppppoooooooopppppqqqqqqqqrrrssttttttttttuuuuuuuuuuuuutttsssssssrrrrqppoooooooooooppoooooooooppppppppppoooooppppppppppppooooopppppooooooooppppqqqrrrrrrssssssttttttttttttttuuuuuuuttttsssrrrqqqpppppoooooooooooooooppppoooooooppppppppooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26748|max=36635&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,5,8,13,14,31,36,60,78,130,170,193,291,293,404,440,484,526,581,622,653,583,632,537,514,452,413,410,319,271,190,174,128,107,66,46,47,20,15,13,5,12,4,3,0,3,0,0,1&chds=0,653&chbh=5&chxt=x&chxl=0:|min=25260|avg=26748|max=28647&chxp=0,1,44,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372_Caster 26748
darkmoon_card_hurricane 747 2.8% 29.4 15.60sec 11510 0 8040 16562 16562 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.36 29.36 0.00 0.00 0.0000 0.0000 337903
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 59.28% 8039.87 8040 8040 139924
crit 12.0 40.72% 16562.13 16562 16562 197979

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1184 4.4% 39.7 11.25sec 13497 10043 10427 16112 19757 54.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.70 39.70 0.00 0.00 1.3439 0.0000 535782
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 46.00% 10427.06 10022 12787 190414
crit 21.4 54.00% 16112.42 15483 19757 345368

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
flame_shock 1547 5.8% 22.9 20.05sec 30600 22735 7011 10834 14164 19.0% 0.0% 0.0% 0.0% 155 3062 4732 18.9% 0.0% 90.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.87 22.87 154.78 154.78 1.3459 2.6560 699784
Direct Results Count Pct Average Min Max Total Damage
hit 18.5 81.02% 7011.21 5582 9167 129898
crit 4.3 18.98% 10833.66 8624 14164 47034
Tick Results Count Pct Average Min Max Total Damage
hit 125.5 81.06% 3061.59 2427 4050 384107
crit 29.3 18.94% 4731.56 3750 6258 138744

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 1735 6.5% 272.8 1.66sec 2876 0 2607 4028 5146 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
272.84 272.84 0.00 0.00 0.0000 0.0000 784816
Direct Results Count Pct Average Min Max Total Damage
hit 221.1 81.05% 2607.20 2468 3331 576512
crit 51.7 18.95% 4027.84 3813 5146 208304

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_burst 1999 7.5% 29.8 14.89sec 30296 16689 0 30306 41647 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.84 29.83 0.00 0.00 1.8154 0.0000 904048
Direct Results Count Pct Average Min Max Total Damage
crit 29.8 100.00% 30306.37 27821 41647 904048

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_lash 3345 12.5% 42.8 10.67sec 35342 23420 24672 50936 62931 40.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.81 42.81 0.00 0.00 1.5091 0.0000 1513053
Direct Results Count Pct Average Min Max Total Damage
hit 25.4 59.37% 24672.20 18215 30549 627155
crit 17.4 40.63% 50935.64 37523 62931 885898

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3808 14.2% 72.4 6.20sec 23779 17625 17670 27266 34011 63.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
72.44 72.41 0.00 0.00 1.3492 0.0000 1722511
Direct Results Count Pct Average Min Max Total Damage
hit 26.3 36.26% 17670.23 16897 22013 463934
crit 46.2 63.74% 27266.18 26106 34011 1258577

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 749 2.8% 41.1 11.05sec 8235 0 6542 10087 12493 52.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.14 41.14 0.00 0.00 0.0000 0.0000 338762
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 45.33% 6541.91 6246 8086 121997
crit 21.5 52.24% 10086.72 9651 12493 216765
none 1.0 2.43% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 1795 6.7% 311.2 1.46sec 2608 2438 2012 4147 5234 40.7% 7.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
311.24 311.24 0.00 0.00 1.0700 0.0000 811829
Direct Results Count Pct Average Min Max Total Damage
hit 86.3 27.74% 2012.23 1913 2541 173746
crit 126.7 40.71% 4146.85 3942 5234 525480
glance 74.6 23.97% 1509.62 1435 1906 112604
dodge 1.5 0.49% 0.00 0 0 0
miss 22.1 7.09% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1036 3.9% 210.3 2.15sec 2228 1443 1712 3528 4313 40.7% 7.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.31 210.31 0.00 0.00 1.5443 0.0000 468524
Direct Results Count Pct Average Min Max Total Damage
hit 59.3 28.21% 1711.94 1641 2094 101575
crit 85.7 40.73% 3527.81 3380 4313 302215
glance 50.4 23.97% 1284.25 1230 1570 64734
miss 14.9 7.09% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 966 3.6% 279.3 1.62sec 1564 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122 3327 5137 14.0% 0.0% 80.9%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.26 279.26 122.03 122.03 0.0000 3.0000 436897
Direct Results Count Pct Average Min Max Total Damage
hit 279.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 105.0 86.02% 3327.47 883 5795 349292
crit 17.1 13.98% 5136.69 1364 8953 87605

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:882.58
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 3144 11.8% 8.1 59.90sec 176285 173997 0 0 0 0.0% 0.0% 0.0% 0.0% 279 4617 7133 18.9% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.07 8.07 279.26 279.26 1.0131 1.6000 1422319
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 226.4 81.07% 4616.66 4413 5794 1045133
crit 52.9 18.93% 7133.27 6818 8951 377185

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 122.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.17 4.17 0.00 0.00 1.2974 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1090 4.1% 46.7 9.69sec 10564 6995 0 0 0 0.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.67 46.67 0.00 0.00 1.5101 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.4 99.50% 0.00 0 0 0
dodge 0.2 0.50% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 589 2.2% 46.4 9.74sec 5733 0 4002 8247 10435 40.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.44 46.44 0.00 0.00 0.0000 0.0000 266226
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.23% 4001.99 3815 5066 110079
crit 18.9 40.77% 8247.07 7859 10435 156147

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 501 1.9% 46.4 9.74sec 4884 0 3411 7028 8599 40.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.44 46.44 0.00 0.00 0.0000 0.0000 226792
Direct Results Count Pct Average Min Max Total Damage
hit 27.5 59.28% 3410.89 3271 4174 93901
crit 18.9 40.72% 7027.61 6738 8599 132891

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.6 16.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 1.3413 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.6 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed. See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 787 2.9% 28.6 16.03sec 12465 0 11291 17444 21215 19.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 0.0000 0.0000 356045
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.92% 11291.34 10847 13768 260997
crit 5.4 19.08% 17443.81 16759 21215 95048

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 225 0.8% 28.6 16.03sec 3569 0 2510 5170 6473 40.3% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.56 28.56 0.00 0.00 0.0000 0.0000 101953
Direct Results Count Pct Average Min Max Total Damage
hit 16.9 59.17% 2509.66 2392 3153 42402
crit 11.5 40.34% 5169.76 4927 6473 59551
dodge 0.1 0.50% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 1545 5.8% 140.8 9.57sec 4963 0 3483 7180 8706 40.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.79 140.79 0.00 0.00 0.0000 0.0000 698667
Direct Results Count Pct Average Min Max Total Damage
hit 83.1 59.01% 3483.34 3348 4226 289386
crit 57.0 40.49% 7179.52 6897 8706 409281
dodge 0.7 0.50% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 919
wolf_melee 919 100.0% 89.3 4.68sec 4317 3199 4583 9145 10840 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.34 89.34 0.00 0.00 1.3494 0.0000 385669
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 75.76% 4582.80 4384 5420 310180
crit 0.2 0.20% 9145.16 8767 10840 1651
glance 21.5 24.04% 3437.48 3288 4065 73839

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 682
earth_melee 682 100.0% 59.0 2.00sec 1482 741 1528 3055 3182 3.0% 0.0% 24.2% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 87433
Direct Results Count Pct Average Min Max Total Damage
hit 43.0 72.80% 1527.69 1441 1591 65619
crit 1.8 3.04% 3055.30 2883 3182 5486
glance 14.3 24.15% 1145.74 1081 1193 16328

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372_Caster
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 10.3% 12.8 1054
flame_shock mana 5.6% 30.7 996
flametongue_oh mana 23.5% 8.2 351
lava_burst mana 17.2% 12.9 2343
lava_lash mana 9.8% 37.7 937
lightning_bolt mana 7.7% 55.1 431
searing_totem mana 0.6% 602.2 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 21.5% 5.6 1874
unleash_elements mana 2.9% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 23835.8 13.2 19.2%
initial_mana none 1.0 28205.0 28205.0 0.0%
mp5_regen mana 1809.9 86443.7 47.8 18.4%
primal_wisdom mana 303.6 285062.6 938.9 19.9%
replenishment mana 1809.9 10334.1 5.7 19.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 4.7 118.6 92.7sec 3.6sec 97% 97%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 862.1 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 66.3 269.9 6.8sec 1.3sec 85% 85%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 9.9 4.3 44.2sec 29.9sec 31% 33%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.0 3.3 47.7sec 34.0sec 28% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 73.2 192.4 6.2sec 1.7sec 72% 67%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.4 45.1 217.3sec 9.7sec 99% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 339.1sec 339.1sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.6 0.0 16.0sec 16.0sec 28% 42%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.6 0.0 16.0sec 16.0sec 21% 29%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Causes ${($26364m1+($SP*0.267))*$} Nature damage to attacker on hit.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 29.4 15.6sec
flametongue_icd 11.8 35.8sec
maelstrom_weapon 265.5 1.9sec
static_shock 40.1 11.2sec
swings_clipped_mh 38.5 11.4sec
swings_clipped_oh 28.9 15.2sec
wasted_maelstrom_weapon 12.9 33.9sec
windfury 46.9 9.6sec

Statistics & Data Analysis

DPS
Population
Convergence 70.76%
σ of the average dps 4.3480
2 * σ / μ 0.0325%
95% Confidence Intervall ( μ ± 2σ ) ( 26738.95 - 26756.35 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26734.61 - 26760.69 )
Sample Data
σ 434.8028
Minimum 25259.89
Maximum 28646.73
Spread ( max - min ) 3386.84
Range ( max - min ) / 2 1693.42
Range% 6.33
10th Percentile 26201.05
90th Percentile 27315.46
( 90th Percentile - 10th Percentile ) 1114.42
Approx. Iterations needed for
1% dps error 10
0.1% dps error 1056
0.1 scale factor error with delta=300 1680
0.05 scale factor error with delta=300 6721
0.01 scale factor error with delta=300 168047
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
R lava_burst,if=dot.flame_shock.remains>cast_time+0.5

Sample Sequence

012378AEFGIJLHMNRKGLQKIQRLGJQQLKRGIQKLQGJQLRIKGQLQFKQGLHIJRLGKQRKIGLHJQRLGHIKHLQRGJLHIKQGEFLKQRMGIJHLQRGKQLQIJQGLQKRLGIJHQLQKGQRKIFLHGJQRLKQGIKLQRKGQLQIJQRGKLQKRGIJLHQRGFEKLQIRGKLMQJQGILHKRGLKHIQGJLHRKGILHJQRFGKLQIRKGLQKQLGIHJRLQGKQLIJRGQKLQRKGILFHEJQRGKLHIMKHGLQJRLGIKHRLKGQJLIQGKQLRKFGQIJLHRGKLQKIGLHJRLGHIKQLQRGHJLQIRGKLFHKERGIJHLHRGKMLHIJQGLQKRQGIJLHRKGQLQKIQRFGJL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7593 4901 4591
Stamina 7540 5923 5774
Intellect 337 321 185
Spirit 244 244 86
Health 142341 119759 0
Mana 28205 27965 0
Spell Power 13755 7646 2207
Spell Hit 17.15% 17.15% 1671
Spell Crit 15.79% 10.76% 908
Spell Haste 9.85% 4.62% 591
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 17848 10257 190
Melee Hit 19.91% 19.91% 1671
Melee Crit 39.36% 26.07% 908
Melee Haste 4.62% 4.62% 591
Expertise 24.02 24.02 481
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.79% 16.40% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.82% 17.82% 1760

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Improved Fire Nova 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372_Caster
origin="http://chardev.org/?profile=39882"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
actions+=/lava_burst,if=dot.flame_shock.remains>cast_time+0.5
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4591
# gear_stamina=5774
# gear_intellect=185
# gear_spirit=86
# gear_spell_power=2207
# gear_attack_power=190
# gear_expertise_rating=481
# gear_hit_rating=1671
# gear_crit_rating=908
# gear_haste_rating=591
# gear_mastery_rating=1760
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=andoros_fist_of_the_dragon_king,heroic=1,weapon=mace_1.80speed_328min_611max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Warlock_AffDrain_T11_372 : 27228dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27227.7 10.66 / 0.04% 18.8 1445.4 1423.2 mana 0.00% 32.9
Origin http://chardev.org/?profile=36745
Talents http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://6.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:134381|71483|21804|16829|15802|15646|13644|9761|8433|5115|2387|574&chds=0,268761&chco=9482C9,9482C9,435133,9482C9,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++134381++bane_of_doom,9482C9,0,0,15|t++71483++unstable_affliction,9482C9,1,0,15|t++21804++fel_flame,435133,2,0,15|t++16829++shadowflame,9482C9,3,0,15|t++15802++shadow_bolt,9482C9,4,0,15|t++15646++drain_soul,9482C9,5,0,15|t++13644++soul_fire,C41F3B,6,0,15|t++9761++drain_life,9482C9,7,0,15|t++8433++haunt,9482C9,8,0,15|t++5115++lash_of_pain,9482C9,9,0,15|t++2387++infernal_melee,C79C6E,10,0,15|t++574++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_AffDrain_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:19,16,15,14,12,9,3,3,3,2,1,1,1,1,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,9482C9,C79C6E,435133,C79C6E,9482C9,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|drain_life|unstable_affliction|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|shadow_bolt|infernal_melee|fel_flame|ebon_imp_melee|shadowflame|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_AffDrain_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s78665yuuuuuuuvuuttsrrrrqqppppponmllkkkkkkkkkjihgggghhhgggggffffeeddddccccbbaaaZZZZZZZYYXXWWWWWWWWWVVVUUUUUVVVVUUUUTTTTTSSSSSSRRQQQQQPQPPQPPPPPPPPPPPPPPQPPPPPPPPPPPPOOOOOOOOOOOOOOONNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNOOOOOOOONONNNNNNNNNNNNNNNNNNNNNNNNMMNMMNNNNNNOOOOOOPOPPPPPPPPPPPPPPPOOOOOOOPPPPPPQQQQQQRRRRSSSSTTTUUUUVVVVVVWWWWWXXXXXXXYYYYYYYXXXXXXXXXXXYYYYZZZZaaaabbbbbccccccddddeeeeeffffggggghhhiiijjjkkjkjjjkkkkllllmmmmmnnn&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=106613&chtt=Warlock_AffDrain_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:kkoqprrsvwwy13457775532212110xxvvttssqtttssroonnmllkknnmmllihhgggggfgghgggddddcccccdeffffedddeeffghijjjkjiiijjjjjkllkkkjihhhhhhhghhihhgffggggggghiijjjiihhhhgggghhhhgfeedddddddeeeeeeddddddeeefghhhhggggggggghhiiihhgggggggghhiiiiihhhhhhhiijjjjjjiihhhhhhhhhhhhgfffeeeeeeeefffffeeeeeeffghiijjiiiiiiiiiijjjjiihgggggggghhiijiiijjjkkllmnooppppooooooooooooonmllkkkjjkkkkkkkjjjjjjkkklmmnnonnnnoooooopppppoonmmmllmmmmnnnnmmmmmmnnoppqqrrqqqrrrrsssttutttssssstttttt&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27228|max=44670&chxp=1,1,61,100&chtt=Warlock_AffDrain_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,5,6,18,19,42,51,77,130,181,226,289,369,386,447,511,586,658,697,655,665,608,569,454,445,362,330,274,225,183,143,100,82,58,48,34,14,17,13,4,6,1,7,0,0,1,0,0,0,1&chds=0,697&chbh=5&chxt=x&chxl=0:|min=25450|avg=27228|max=29612&chxp=0,1,43,100&chtt=Warlock_AffDrain_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_AffDrain_T11_372 27228
bane_of_doom 2315 8.5% 7.6 61.09sec 137443 134381 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26700 55265 33.2% 0.0% 96.0%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.61 7.61 28.92 28.92 1.0228 15.0000 1046474
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.3 66.80% 26700.11 18549 40983 515817
crit 9.6 33.20% 55265.30 38115 81480 530657

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3823 14.0% 1.0 1.04sec 1726670 1665309 0 0 0 0.0% 0.1% 0.0% 0.0% 208 5828 12063 40.0% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 207.67 207.67 1.0368 2.1680 1728397
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.6 59.99% 5828.08 3573 9537 726007
crit 83.1 40.01% 12063.10 7342 18911 1002389

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.53sec 3096 0 2699 4176 4896 27.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.12 10.12 0.00 0.00 0.0000 0.0000 31328
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.77% 2699.49 2602 3169 19874
crit 2.7 27.11% 4175.88 4020 4896 11454
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 2.9 133.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.90 2.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.9 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 4443 16.3% 85.6 3.89sec 23456 9761 0 0 0 0.0% 0.1% 0.0% 0.0% 257 6174 12804 24.9% 0.0% 40.8%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.64 85.64 256.64 256.64 2.4029 0.7180 2008805
Direct Results Count Pct Average Min Max Total Damage
hit 85.5 99.89% 0.00 0 0 0
miss 0.1 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 192.6 75.06% 6173.51 3701 9340 1189171
crit 64.0 24.94% 12804.14 7604 19193 819634

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3337 12.3% 13.2 8.67sec 114205 15646 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28239 58510 25.4% 0.0% 20.6%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.21 13.21 42.01 42.01 7.2993 2.2216 1508660
Direct Results Count Pct Average Min Max Total Damage
hit 13.2 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.65% 28238.98 16496 42410 885555
crit 10.6 25.35% 58509.75 33897 87146 623105

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 297 1.1% 5.5 33.23sec 24505 21804 19326 39969 59641 25.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.49 5.49 0.00 0.00 1.1239 0.0000 134478
Direct Results Count Pct Average Min Max Total Damage
hit 4.1 74.68% 19325.65 17198 29025 79204
crit 1.4 25.20% 39969.23 35339 59641 55273
miss 0.0 0.12% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 921 3.4% 43.4 10.44sec 9605 8433 7614 15813 24071 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.35 43.16 0.00 0.00 1.1390 0.0000 416394
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 74.98% 7614.45 6621 12120 246418
crit 10.7 24.90% 15812.91 13606 24071 169976
miss 0.1 0.12% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17170 0 13249 27362 29899 27.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17170
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.95% 13249.48 10344 14551 9533
crit 0.3 27.91% 27362.23 21256 29899 7637
miss 0.0 0.14% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 2.8 68.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.80 2.80 0.00 0.00 1.0100 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 784 2.9% 20.0 16.24sec 17759 15802 14005 29059 45864 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.95 19.95 0.00 0.00 1.1238 0.0000 354324
Direct Results Count Pct Average Min Max Total Damage
hit 14.9 74.82% 14005.50 12023 22320 209063
crit 5.0 25.05% 29059.28 24705 45864 145262
miss 0.0 0.13% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1054 3.9% 25.1 13.55sec 18955 16829 2508 5185 6805 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.14 25.14 0.00 0.00 1.1263 0.0000 79874
Direct Results Count Pct Average Min Max Total Damage
hit 18.8 74.79% 2508.17 2313 3312 47163
crit 6.3 25.09% 5185.46 4753 6805 32711
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 877 3.2% 25.1 13.55sec 15778 0 0 0 0 25.0% 0.1% 0.0% 0.0% 110 2849 5911 25.1% 0.0% 34.7%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.14 25.14 109.63 109.63 0.0000 1.4309 396673
Direct Results Count Pct Average Min Max Total Damage
hit 18.8 74.86% 0.00 0 0 0
crit 6.3 25.03% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 82.1 74.88% 2849.35 2489 4196 233892
crit 27.5 25.12% 5910.56 5114 8622 162781

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 101 0.4% 3.0 46.91sec 15272 13644 11796 24456 29262 27.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1194 0.0000 45817
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.34% 11795.70 9322 14240 25599
crit 0.8 27.56% 24456.34 19154 29262 20218
miss 0.0 0.10% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4082 15.0% 22.6 15.38sec 81636 71483 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6221 12870 40.1% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.61 22.61 207.66 207.66 1.1420 2.1569 1845457
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.4 59.91% 6221.37 3818 10082 774014
crit 83.2 40.09% 12870.19 7846 20717 1071443

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5132
lash_of_pain 5132 100.0% 301.2 1.51sec 7698 5115 6113 12304 18163 26.6% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.20 301.20 0.00 0.00 1.5051 0.0000 2318588
Direct Results Count Pct Average Min Max Total Damage
hit 218.1 72.40% 6113.32 5396 9104 1333109
crit 80.1 26.59% 12303.90 10766 18163 985478
miss 3.0 1.01% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 5660
infernal_immolation 1503 26.6% 1.0 0.00sec 76933 319746213 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3532 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0002 0.0000 76933
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 99.02% 3531.55 2696 3830 76933
miss 0.2 0.98% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 4157 73.4% 82.0 0.54sec 2594 2387 2590 5197 5478 20.5% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.99 81.99 0.00 0.00 1.0871 0.0000 212714
Direct Results Count Pct Average Min Max Total Damage
hit 33.6 41.00% 2589.65 2183 2739 87048
crit 16.8 20.51% 5196.50 4367 5478 87369
glance 19.7 24.02% 1944.78 1638 2054 38298
dodge 5.3 6.50% 0.00 0 0 0
miss 6.5 7.98% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 221
ebon_imp_melee 221 100.0% 110.8 0.69sec 794 574 822 1644 1644 17.0% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.78 110.78 0.00 0.00 1.3836 0.0000 87917
Direct Results Count Pct Average Min Max Total Damage
hit 49.3 44.52% 822.05 822 822 40541
crit 18.9 17.03% 1644.11 1644 1644 31016
glance 26.5 23.95% 616.54 617 617 16360
dodge 7.2 6.48% 0.00 0 0 0
miss 8.9 8.02% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_AffDrain_T11_372
bane_of_doom mana 3.6% 44.6 3082
corruption mana 0.2% 1400.4 1233
demon_soul mana 1.4% 0.0 3082
drain_life mana 32.3% 9.5 2466
drain_soul mana 5.8% 39.7 2877
fel_flame mana 1.0% 19.9 1233
haunt mana 16.4% 3.9 2466
infernal mana 2.5% 0.0 16442
shadow_bolt mana 5.3% 10.2 1746
shadowflame mana 19.8% 3.7 5138
soul_fire mana 0.8% 8.3 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 10.7% 26.5 3082
pet - succubus
lash_of_pain mana 100.0% 13.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29288.6 16.2 0.7%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 2.8 92399.6 32976.3 0.0%
mana_feed mana 80.1 371480.1 4638.0 0.8%
mp5_regen mana 1809.9 92261.9 51.0 0.7%
replenishment mana 1809.9 52162.1 28.8 0.7%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 2.8 281.6 100.5 99.5%
mana_spring_totem mana 1809.9 8859.1 4.9 70.0%
mp5_regen mana 1809.9 154212.7 85.2 61.6%
replenishment mana 1809.9 8815.7 4.9 69.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.9sec 106.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 121.1sec 121.1sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 67.0 0.0 6.7sec 6.7sec 15% 15%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.5sec 46.5sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 2.9 0.0 133.6sec 133.6sec 13% 30%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.7sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 3.2 39.9 104.5sec 10.5sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.9 0.0 47.5sec 47.5sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 2.2 60.9 144.9sec 7.1sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 23.0 3.9 18.6sec 15.9sec 19% 100%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.9sec 46.9sec 0% 1%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.4 88.0sec 78.5sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.6sec 363.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.7sec
shadow_trance 26.9 15.9sec

Statistics & Data Analysis

DPS
Population
Convergence 67.39%
σ of the average dps 5.3304
2 * σ / μ 0.0392%
95% Confidence Intervall ( μ ± 2σ ) ( 27217.06 - 27238.38 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27211.73 - 27243.71 )
Sample Data
σ 533.0412
Minimum 25450.22
Maximum 29612.01
Spread ( max - min ) 4161.78
Range ( max - min ) / 2 2080.89
Range% 7.64
10th Percentile 26434.91
90th Percentile 27760.41
( 90th Percentile - 10th Percentile ) 1325.51
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1533
0.1 scale factor error with delta=300 2525
0.05 scale factor error with delta=300 10102
0.01 scale factor error with delta=300 252562
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G soulburn
H soul_fire,if=buff.soulburn.up
I demon_soul,if=buff.shadow_trance.react
J shadow_bolt,if=buff.shadow_trance.react
K life_tap,mana_percentage<=5
L drain_life
M life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
N fel_flame,moving=1
O life_tap

Sample Sequence

012346789ABDFGHLCCIJBLJLFL9BJLLLLBFL9JLLBLLFLL9BGHJLLFABJL9LLBFLL9LBLFLL9BJGHLFLB9LLJFBCL6ALL9BFLLIJLBL9FJLBLLL9BFLLJLB9JFLLBLAK9FLBLCLLBCFLL9BJLLFJLBCLCLFBL9LLBF6AJL9LBJFLLIJ9BLFJLJBL9LFLBJL9LFBLLLLA9BFLLLBL9FKLBLCLCFBJCLCLBFLL9LBLFL6JA9BLJLFLB9LLKFBLIJL9LBFLLLBEBEAEBE7EBEBEBEBEBE6EAEBEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 152668 128504 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 0
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_AffDrain_T11_372
origin="http://chardev.org/?profile=36745"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul,if=buff.shadow_trance.react
actions+=/shadow_bolt,if=buff.shadow_trance.react
actions+=/life_tap,mana_percentage<=5
actions+=/drain_life
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Affliction_T11_372 : 26964dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26964.3 10.91 / 0.04% 19.4 1391.5 1234.4 mana 0.00% 36.8
Origin http://chardev.org/?profile=36750
Talents http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • lash_of_pain
  • haunt

Charts

http://7.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:72572|22027|17000|15675|13552|9960|8547|5112|2386|573&chds=0,145144&chco=9482C9,435133,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++72572++unstable_affliction,9482C9,0,0,15|t++22027++fel_flame,435133,1,0,15|t++17000++shadowflame,9482C9,2,0,15|t++15675++drain_soul,9482C9,3,0,15|t++13552++soul_fire,C41F3B,4,0,15|t++9960++shadow_bolt,9482C9,5,0,15|t++8547++haunt,9482C9,6,0,15|t++5112++lash_of_pain,9482C9,7,0,15|t++2386++infernal_melee,C79C6E,8,0,15|t++573++ebon_imp_melee,C79C6E,9,0,15&chtt=Warlock_Affliction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:19,18,15,14,12,9,4,3,2,1,1,1,1,0,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B,C79C6E,435133,C79C6E,9482C9,C41F3B,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|unstable_affliction|corruption|drain_soul|bane_of_doom|haunt|shadowflame_dot|infernal_melee|fel_flame|ebon_imp_melee|shadowflame|infernal_immolation|soul_fire|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Affliction_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77644vrqpoonnmlkjjhfffedcccbbaYXWdjllllkkkjigfeeddddehknooooonmlkkkjjihgfeddcccbbaZZYZZbeghijkkjjihgffeeffghhhhhgggghiijjjjihggfedcbbaaZZZZabdgijkkkjjihhgffeeeddccbbaabbcdfghiijiihhggfedccccdegiklmnnmmllkjiihggffeddccbaaaaaabcdeffghhhhhhgggfffffffghijjkkkkjjiihhgffeedccbbaaaaabcdefghhihhhggfffeeeeddddccccccccdeeeeeeedddccbbbaabbccdeefffffeeeddddcccbbbaaaaZZZZZZZZZZZZZZZZYYYYYYYYYZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYXXXXXXXXXXXXWWVVVVVVVVVVVVUUUUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105268&chtt=Warlock_Affliction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fhknoqqruvvy02458665654533110xwvuttrrqtssrqqnnmmlllkkmmllkjggfffffeefggfffccccccccbcdddeedccddddeefghhiiihhhhiihhijkkjjihhggggggghiihhgffffffffghiiiiihgggggffgghhhggedddcccccdeeeedccccccccddeffggfeeeefffffghhhhhggffffffgghhhhhgggfffggghhiiihhggggggggghhhhhgffeeeeeeeffffffeddddddeefghhhhhgggghhhiijjjjihhgggggggghiiiiihiiijjkklmnnooonnnnnnnnnooooonmllkkkkjkkkkkkjjiiiiijjjkllmnnmmmmnnnnoooppppponnmmmmmmmnnnnnmmlllmmmnooppppppppqqqrrsttuuuttssttttttttu&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26964|max=45063&chxp=1,1,60,100&chtt=Warlock_Affliction_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,5,7,9,18,28,42,64,68,127,133,177,225,274,340,391,459,516,563,573,555,531,578,549,523,482,443,392,352,289,235,199,197,144,115,110,71,56,43,26,22,15,22,6,4,7,6,2,3&chds=0,578&chbh=5&chxt=x&chxl=0:|min=25088|avg=26964|max=28857&chxp=0,1,50,100&chtt=Warlock_Affliction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Affliction_T11_372 26964
bane_of_doom 2329 8.6% 7.6 60.91sec 137973 136469 0 0 0 0.0% 0.1% 0.0% 0.0% 29 26808 55469 33.2% 0.0% 96.2%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.63 7.63 29.00 29.00 1.0110 15.0000 1053131
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 66.83% 26807.52 18549 39652 519535
crit 9.6 33.17% 55469.11 38115 81318 533596

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 3872 14.4% 1.0 167.40sec 1691836 1626839 0 0 0 0.0% 0.1% 0.0% 0.0% 208 5874 12161 40.2% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 208.44 208.44 1.0400 2.1600 1750543
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.7 59.85% 5873.95 4002 9537 732729
crit 83.7 40.15% 12161.04 8224 18911 1017813

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.3% 10.1 46.71sec 3091 0 2695 4172 4896 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.08 10.08 0.00 0.00 0.0000 0.0000 31157
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.89% 2695.39 2602 3169 19802
crit 2.7 27.00% 4171.60 4020 4896 11354
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_soul 3354 12.4% 13.2 8.72sec 115294 15675 0 0 0 0.0% 0.1% 0.0% 0.0% 42 28255 58609 25.4% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.15 13.15 42.15 42.15 7.3553 2.2218 1516243
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.4 74.57% 28255.14 16496 40868 888059
crit 10.7 25.43% 58608.54 35621 83789 628184

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 304 1.1% 5.6 32.44sec 24467 22027 19366 40180 59641 24.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.61 5.61 0.00 0.00 1.1108 0.0000 137282
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 75.29% 19366.37 17198 29025 81813
crit 1.4 24.60% 40179.90 35339 59641 55468
miss 0.0 0.10% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 954 3.5% 44.8 10.08sec 9623 8547 7622 15812 24022 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.84 44.65 0.00 0.00 1.1259 0.0000 431506
Direct Results Count Pct Average Min Max Total Damage
hit 33.4 74.87% 7622.08 6621 11690 254831
crit 11.2 25.02% 15811.53 13606 24022 176675
miss 0.0 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:709.24
  • base_dd_max:709.24
infernal_awakening 38 0.1% 1.0 0.00sec 17240 0 13253 27348 29899 28.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 17240
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.50% 13253.36 10344 14551 9476
crit 0.3 28.39% 27348.20 21256 29899 7764
miss 0.0 0.11% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
life_tap 0 0.0% 11.7 27.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.70 11.70 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 11.7 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 4801 17.8% 124.0 2.69sec 17512 9960 13832 28706 45864 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.96 123.96 0.00 0.00 1.7581 0.0000 2170778
Direct Results Count Pct Average Min Max Total Damage
hit 93.0 75.04% 13831.78 12023 22320 1286607
crit 30.8 24.85% 28706.12 24705 45864 884171
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1068 4.0% 25.5 13.36sec 18954 17000 2510 5183 6805 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.48 25.48 0.00 0.00 1.1149 0.0000 80881
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 74.92% 2510.12 2313 3312 47913
crit 6.4 24.97% 5183.03 4753 6805 32968
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 889 3.3% 25.5 13.36sec 15779 0 0 0 0 25.0% 0.1% 0.0% 0.0% 111 2850 5911 25.0% 0.0% 35.2%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.48 25.48 111.16 111.16 0.0000 1.4303 402025
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 74.92% 0.00 0 0 0
crit 6.4 24.96% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 83.3 74.96% 2850.26 2489 4196 237497
crit 27.8 25.04% 5911.06 5114 8622 164528

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 101 0.4% 3.0 46.87sec 15168 13552 11735 24380 29262 27.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1192 0.0000 45503
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 72.63% 11735.21 9322 14240 25570
crit 0.8 27.25% 24380.03 19154 29262 19933
miss 0.0 0.12% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4114 15.3% 22.6 15.39sec 82417 72572 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6261 12956 40.1% 0.0% 99.1%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.57 22.57 207.91 207.91 1.1357 2.1560 1860059
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.5 59.89% 6261.03 4277 10082 779566
crit 83.4 40.11% 12956.41 8788 20717 1080493

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - succubus 5129
lash_of_pain 5129 100.0% 301.2 1.51sec 7694 5112 6113 12300 18163 26.5% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.20 301.20 0.00 0.00 1.5051 0.0000 2317308
Direct Results Count Pct Average Min Max Total Damage
hit 218.2 72.44% 6112.50 5396 9104 1333711
crit 80.0 26.55% 12299.86 10766 18163 983596
miss 3.0 1.01% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 5659
infernal_immolation 1504 26.6% 1.0 0.00sec 76952 316483506 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3533 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0002 0.0000 76952
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.8 99.01% 3532.80 2696 3830 76952
miss 0.2 0.99% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 4155 73.4% 82.0 0.54sec 2593 2386 2590 5199 5478 20.5% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.99 81.99 0.00 0.00 1.0871 0.0000 212640
Direct Results Count Pct Average Min Max Total Damage
hit 33.6 41.01% 2590.08 2183 2739 87081
crit 16.8 20.49% 5198.66 4367 5478 87324
glance 19.7 23.97% 1945.18 1638 2054 38235
dodge 5.3 6.50% 0.00 0 0 0
miss 6.6 8.03% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 221
ebon_imp_melee 221 100.0% 110.7 0.69sec 793 573 822 1644 1644 17.0% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
110.73 110.73 0.00 0.00 1.3834 0.0000 87830
Direct Results Count Pct Average Min Max Total Damage
hit 49.3 44.51% 822.05 822 822 40512
crit 18.8 17.00% 1644.11 1644 1644 30950
glance 26.6 23.98% 616.54 617 617 16369
dodge 7.2 6.47% 0.00 0 0 0
miss 8.9 8.04% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Affliction_T11_372
bane_of_doom mana 3.7% 44.8 3082
corruption mana 0.2% 1372.1 1233
demon_soul mana 1.6% 0.0 3082
drain_soul mana 6.0% 40.1 2877
fel_flame mana 1.1% 19.8 1233
haunt mana 17.6% 3.9 2466
infernal mana 2.6% 0.0 16442
shadow_bolt mana 34.4% 10.0 1746
shadowflame mana 20.8% 3.7 5138
soul_fire mana 0.9% 8.2 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 11.1% 26.7 3082
pet - succubus
lash_of_pain mana 100.0% 13.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29438.2 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 11.7 377720.1 32289.8 0.0%
mp5_regen mana 1809.9 92725.7 51.2 0.2%
replenishment mana 1809.9 52384.6 28.9 0.2%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_spring_totem mana 1809.9 8920.8 4.9 69.8%
mp5_regen mana 1809.9 154356.4 85.3 61.5%
replenishment mana 1809.9 8894.0 4.9 69.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.5sec 106.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.9sec 120.9sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 180.2 0.0 2.5sec 2.5sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_succubus 3.3 0.0 121.6sec 121.6sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.6 3.0 44.5sec 33.2sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.4 43.3 216.2sec 10.1sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 47.9sec 47.9sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.1 167.3 393.7sec 2.6sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 15.2 1.5 28.1sec 25.6sec 12% 10%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.9sec 46.9sec 0% 60%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 86.8sec 78.2sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.6sec 363.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.8sec
shadow_trance 16.7 25.6sec

Statistics & Data Analysis

DPS
Population
Convergence 67.43%
σ of the average dps 5.4543
2 * σ / μ 0.0405%
95% Confidence Intervall ( μ ± 2σ ) ( 26953.36 - 26975.18 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26947.90 - 26980.63 )
Sample Data
σ 545.4308
Minimum 25088.38
Maximum 28857.05
Spread ( max - min ) 3768.67
Range ( max - min ) / 2 1884.34
Range% 6.99
10th Percentile 26169.57
90th Percentile 27519.20
( 90th Percentile - 10th Percentile ) 1349.64
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1636
0.1 scale factor error with delta=300 2644
0.05 scale factor error with delta=300 10577
0.01 scale factor error with delta=300 264439
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 corruption,if=(!ticking|remains<tick_time)&miss_react
9 unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
A bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
B haunt
C fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
D summon_infernal
E drain_soul,interrupt=1,if=target.health_pct<=25
F shadowflame
G life_tap,mana_percentage<=35
H soulburn
I soul_fire,if=buff.soulburn.up
J demon_soul
K shadow_bolt
L life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
M fel_flame,moving=1
N life_tap

Sample Sequence

012346789ABDFHIJKKKKB9KKFKKBCCKKKKBFKK9GKKBKKFKK9BHIGKKFK9ABKKKFKBK9KKKBFKK9GKBKFHIKK9BKKFKCBKC6KKABFG9JKKKBKFGK9KBKKFKKB9KKKKFBKKKK9BKFGKKKA9BKFGKKKBKK9FKBKKKKK9BFKKKKBCGKFKK9BK6KKFAKBK9JKKKBFGKK9KBKKFKKBGK9KFKBKCCKKKBFK9KKABKCFGCKKBKCCKFKBKK9GKKBFKKKKB9KKFKKBKK6KK9BAFGKKJKB9KKFKKBKK9KFBGKKCKKBCEBEBAE7BEBEBEBEBE6EABEBEBEBEBE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 7977 6289 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 149490 125956 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 1
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 0
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Affliction_T11_372
origin="http://chardev.org/?profile=36750"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
glyphs=life_tap/shadow_bolt/corruption/lash_of_pain/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_infernal
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/life_tap,mana_percentage<=35
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Demonology_T11_372 : 27482dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27482.1 14.17 / 0.05% 16.9 1624.9 1547.2 mana 0.00% 42.7
Origin http://chardev.org/?profile=36757
Talents http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • immolate
  • lash_of_pain
  • metamorphosis

Charts

http://8.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:83346|69314|31467|23712|20822|16676|13360|12136|10182|7034|2490|567&chds=0,166692&chco=9482C9,C41F3B,9482C9,435133,9482C9,435133,C41F3B,C41F3B,9482C9,9482C9,C79C6E,C79C6E&chm=t++83346++bane_of_doom,9482C9,0,0,15|t++69314++immolation_aura,C41F3B,1,0,15|t++31467++corruption,9482C9,2,0,15|t++23712++fel_flame,435133,3,0,15|t++20822++shadowflame,9482C9,4,0,15|t++16676++hand_of_guldan,435133,5,0,15|t++13360++incinerate,C41F3B,6,0,15|t++12136++soul_fire,C41F3B,7,0,15|t++10182++shadow_bolt,9482C9,8,0,15|t++7034++lash_of_pain,9482C9,9,0,15|t++2490++infernal_melee,C79C6E,10,0,15|t++567++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_Demonology_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:26,17,10,7,7,6,6,6,4,3,3,2,2,1,1,0,0&chds=0,100&chco=9482C9,9482C9,C41F3B,9482C9,C41F3B,9482C9,435133,C41F3B,C41F3B,C41F3B,C79C6E,C79C6E,435133,9482C9,C41F3B,C41F3B,C41F3B&chl=lash_of_pain|shadow_bolt|immolate|corruption|soul_fire|bane_of_doom|hand_of_guldan|shadowflame_dot|incinerate|immolation_aura|infernal_melee|ebon_imp_melee|fel_flame|shadowflame|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Demonology_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t77766662yyyyzzzzzxyyyyyyyyyyywwwwwwwwwwwwxvvvvvwwxyxyzzzzzz00zzzzzzzzzzyyyyyyyyyxxxxwwwwwwwwvvvvvvuuvwwxxxxxwxwwwwwwwwxxwwvuvvvvuuuuuuuuutttttuuuvvvvvvwwxxxxxxxyxxxxxxwwwwwwwwwwvvvvvuuuuuutuuuuvvwwwwwwwwwwwwwwwwwwwwwwvvwwwwwwwwwwvvvvvwwwxxxyyyyxxxyyyxxxxwwwwwwvwvvvvvvvvvvvuuuvvuvvuvvvvvvwwwxwwxxxxxwwwwwwvvvvvvvvvvvvvvuuuuuuuuuuvvvvvvvwwwwwwwwwwwwwvvvvvvvvvuvvuuuutttttttssssssssttttttttttttttsstttsssssssssrrrrrrqqrrqrrqrqqqqqqqqqqqqqqqqqqqqqqqqpppp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=104790&chtt=Warlock_Demonology_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:rruvvx00022446777552333111ywvurqpppnpoonnmkkjihihggiiiiiiggfffffedeedddcaZZYZZYYYYZZYZZYYYZaaabbdeeeffeeeeeefffggggffeddddccccccdddcbaaaaaabbabcccbbbaaaaaaaaabaaaZYYXXXYYYYYZZZZZYXXXYYZZZabbbccbbbbbccccccddccccbbbbbcbcccccccccbbccccccccccbbbbbbbbbabbbbbbaaZZZZZZZZZaZaaZZYZYZZZZZabbcccbbbcccccccccccbbaaaaaaaaaaabbaaaabbbcccddeefffeeeeeeeeeeeeeddccbbaaaaaabbaaaaZZZZZZaaabbccccccccccddddddddcccbbbbbbbbbbbbbaaaaabbbccdddedddddddeeeffffffeeddddddedeefee&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27482|max=55051&chxp=1,1,50,100&chtt=Warlock_Demonology_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,0,1,7,9,10,20,35,52,72,122,149,204,240,326,361,523,513,575,600,599,612,619,566,550,466,470,403,362,314,268,215,197,121,99,92,62,60,33,22,23,6,6,5,5,1,1,3&chds=0,619&chbh=5&chxt=x&chxl=0:|min=24935|avg=27482|max=29305&chxp=0,1,58,100&chtt=Warlock_Demonology_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Demonology_T11_372 27482
bane_of_doom 1654 6.0% 7.7 60.77sec 97386 83346 0 0 0 0.0% 0.1% 0.0% 0.0% 29 20206 41778 25.1% 0.0% 96.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 29.21 29.21 1.1684 15.0000 748262
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.9 74.90% 20206.06 14595 33459 442030
crit 7.3 25.10% 41777.88 29990 68754 306232

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 1958 7.1% 24.2 18.69sec 36568 31467 0 0 0 0.0% 0.1% 0.0% 0.0% 197 3540 7357 25.2% 0.0% 99.0%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.22 24.22 196.76 196.76 1.1621 2.2755 885714
Direct Results Count Pct Average Min Max Total Damage
hit 24.2 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.2 74.82% 3540.39 2574 6407 521193
crit 49.5 25.18% 7357.15 5289 13165 364521

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 97 0.4% 10.2 46.63sec 4329 0 3775 5856 8485 26.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.15 10.15 0.00 0.00 0.0000 0.0000 43947
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 73.06% 3774.89 3052 5492 27996
crit 2.7 26.83% 5856.20 4715 8485 15951
miss 0.0 0.11% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 121.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 475 1.7% 7.8 35.34sec 27688 23712 21847 45520 82686 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.76 7.75 0.00 0.00 1.1677 0.0000 214956
Direct Results Count Pct Average Min Max Total Damage
hit 5.8 74.87% 21846.65 16138 40239 126719
crit 1.9 25.02% 45520.20 33162 82686 88236
miss 0.0 0.10% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
hand_of_guldan 1639 6.0% 31.3 14.50sec 23691 16676 18674 38824 69296 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.29 31.27 0.00 0.00 1.4207 0.0000 741237
Direct Results Count Pct Average Min Max Total Damage
hit 23.4 74.82% 18674.20 13933 33723 436974
crit 7.8 25.06% 38824.37 28630 69296 304263
miss 0.0 0.12% 0.00 0 0 0

Action details: hand_of_guldan

Static Values
  • id:71521
  • school:shadowflame
  • resource:mana
  • tree:demonology
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a falling meteor down upon the enemy target, dealing $71521s1 Shadow damage and erupts an aura of magic within $86000a1 yards, causing all targets within it to have a $86000s1% increased chance to be critically hit by any Warlock demons. The aura lasts for $86041d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.968000
  • base_dd_min:1405.76
  • base_dd_max:1660.24
immolate 2861 10.4% 1.0 219.76sec 1251596 1237323 8487 17628 20409 28.3% 0.1% 0.0% 0.0% 196 5151 10715 25.2% 0.0% 99.1%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 195.77 195.77 1.0115 2.2891 1293900
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 71.54% 8487.42 4297 9932 6277
crit 0.3 28.34% 17627.90 8830 20409 5165
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 146.5 74.84% 5150.54 3781 8907 754578
crit 49.3 25.16% 10715.38 7769 18302 527880

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
immolation_aura 745 2.7% 5.0 95.11sec 67438 69314 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3378 0 0.0% 0.1% 0.0%

Stats details: immolation_aura

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 99.92 0.9729 0.0000 337145
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 99.8 99.89% 3377.86 2914 4272 337145
miss 0.1 0.11% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:50590
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites the area surrounds you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.100000
  • base_dd_min:566.82
  • base_dd_max:566.82

Action details: immolation_aura

Static Values
  • id:50589
  • school:fire
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:13153.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damaging all nearby enemies.
  • description:Ignites the area surrounding you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 1173 4.3% 31.8 12.33sec 16698 13360 13240 27454 49892 25.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.78 31.63 0.00 0.00 1.2498 0.0000 530610
Direct Results Count Pct Average Min Max Total Damage
hit 23.7 74.92% 13239.95 8381 24280 313770
crit 7.9 24.97% 27454.07 20322 49892 216840
miss 0.0 0.12% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 72 0.3% 1.0 0.00sec 32633 0 24844 50967 51815 30.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 32633
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 69.89% 24843.94 20512 25216 17363
crit 0.3 29.96% 50967.48 38672 51815 15270
miss 0.0 0.15% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
metamorphosis 0 0.0% 5.0 95.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.00 5.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0

Action details: metamorphosis

Static Values
  • id:47241
  • school:physical
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • description:You transform into a Demon for $47241d. This form increases your armor contribution from items by $47241s2%, damage by $47241s3%, reduces the chance you'll be critically hit by melee attacks by $54879s1% and reduces the duration of stun and snare effects by $54817s1%. You gain some unique demon abilities in addition to your normal abilities.
shadow_bolt 4565 16.6% 104.6 3.20sec 19748 10182 15588 32377 63585 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
104.56 104.56 0.00 0.00 1.9394 0.0000 2064800
Direct Results Count Pct Average Min Max Total Damage
hit 78.4 75.00% 15587.81 11282 30944 1222441
crit 26.0 24.88% 32376.87 23183 63585 842359
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1860 6.8% 34.6 13.17sec 24344 20822 2822 5842 9435 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.56 34.56 0.00 0.00 1.1691 0.0000 123593
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 74.82% 2822.25 2171 4592 72985
crit 8.7 25.06% 5842.21 4461 9435 50608
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1587 5.8% 34.6 13.17sec 20768 0 0 0 0 25.2% 0.1% 0.0% 0.0% 140 4039 8396 25.1% 0.0% 47.4%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.56 34.56 139.82 139.82 0.0000 1.5334 717826
Direct Results Count Pct Average Min Max Total Damage
hit 25.8 74.71% 0.00 0 0 0
crit 8.7 25.18% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.7 74.87% 4039.25 2919 7272 422847
crit 35.1 25.13% 8396.05 5998 14942 294979

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1864 6.8% 48.5 9.36sec 17399 12136 13906 28835 50710 25.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.46 47.68 0.00 0.00 1.4337 0.0000 843138
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 74.48% 13905.60 10934 24678 493781
crit 12.1 25.41% 28834.78 22468 50710 349356
miss 0.1 0.11% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - succubus 7057
lash_of_pain 7057 100.0% 301.2 1.51sec 10587 7034 7820 15692 23202 36.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.20 301.20 0.00 0.00 1.5051 0.0000 3188725
Direct Results Count Pct Average Min Max Total Damage
hit 189.3 62.85% 7819.65 6893 11630 1480266
crit 108.9 36.15% 15691.72 13752 23202 1708458
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - infernal 5995
infernal_immolation 1618 27.0% 1.0 0.00sec 119448 490677729 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3771 0 0.0% 1.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 32.00 0.0002 0.0000 119448
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.7 99.00% 3770.59 2835 3830 119448
miss 0.3 1.00% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 4377 73.0% 118.0 0.55sec 2738 2490 2709 5420 5478 21.5% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.99 117.99 0.00 0.00 1.0995 0.0000 323070
Direct Results Count Pct Average Min Max Total Damage
hit 47.2 39.99% 2709.40 2251 2739 127843
crit 25.4 21.54% 5419.65 4503 5478 137721
glance 28.3 23.98% 2032.42 1689 2054 57506
dodge 7.7 6.52% 0.00 0 0 0
miss 9.4 7.97% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 501
ebon_imp_melee 501 100.0% 278.1 0.70sec 793 567 822 1644 1644 17.0% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
278.10 278.10 0.00 0.00 1.3998 0.0000 220650
Direct Results Count Pct Average Min Max Total Damage
hit 123.9 44.55% 822.05 822 822 101839
crit 47.3 17.00% 1644.11 1644 1644 77710
glance 66.7 23.97% 616.54 617 617 41101
dodge 18.0 6.48% 0.00 0 0 0
miss 22.3 8.01% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Demonology_T11_372
bane_of_doom mana 3.2% 31.6 3082
corruption mana 4.1% 29.7 1233
demon_soul mana 1.4% 0.0 3082
fel_flame mana 1.3% 22.5 1233
hand_of_guldan mana 6.1% 16.5 1438
immolate mana 0.2% 761.3 1644
immolation_aura mana 7.2% 6.4 10522
incinerate mana 12.4% 5.8 2877
infernal mana 2.2% 0.0 16442
shadow_bolt mana 24.8% 11.3 1746
shadowflame mana 24.2% 4.7 5138
soul_fire mana 12.2% 9.4 1849
soulburn soul_shards 100.0% 0.0 1
pet - succubus
lash_of_pain mana 100.0% 18.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29099.6 16.1 1.4%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100118.0 100118.0 0.0%
life_tap mana 0.9 24407.7 28054.8 0.0%
mana_feed mana 108.9 496862.4 4563.5 2.2%
mp5_regen mana 1809.9 91673.6 50.7 1.4%
replenishment mana 1809.9 51860.0 28.7 1.3%
pet - succubus mana
initial_mana none 1.0 60142.7 60142.7 0.0%
mana_feed mana 0.9 82.8 95.2 99.4%
mana_spring_totem mana 1809.9 8886.6 4.9 69.9%
mp5_regen mana 1809.9 154355.5 85.3 61.6%
replenishment mana 1809.9 8845.4 4.9 69.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.6sec 104.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 216.0 0.0 2.1sec 2.1sec 77% 77%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
decimation 1.0 53.5 61.4sec 2.1sec 24% 94%

Database details

  • id:63167
  • cooldown name:buff_decimation
  • tooltip:Your Soul Fire cast time is reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
demon_soul_succubus 3.3 0.0 122.0sec 122.0sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
hand_of_guldan 8.8 22.4 49.2sec 14.5sec 97% 97%

Database details

  • id:
  • cooldown name:buff_hand_of_guldan
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
metamorphosis 5.0 0.0 95.3sec 95.3sec 39% 68%

Database details

  • id:47241
  • cooldown name:buff_metamorphosis
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • max_stacks:1
  • duration:36.00
  • cooldown:0.00
  • default_chance:100.00%
molten_core 10.2 1.6 41.1sec 35.2sec 16% 100%

Database details

  • id:71165
  • cooldown name:buff_molten_core
  • tooltip:Increases damage done by $71165s1% and reduces cast time by $71165s3% of your Incinerate.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:6.00%
power_torrent_mh 9.9 0.0 47.9sec 47.9sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 46.7sec 46.7sec 0% 6%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.9 0.1 83.0sec 81.5sec 2% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.1sec 363.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 14.6 29.3sec
impending_doom 25.2 16.1sec

Statistics & Data Analysis

DPS
Population
Convergence 56.59%
σ of the average dps 7.0852
2 * σ / μ 0.0516%
95% Confidence Intervall ( μ ± 2σ ) ( 27467.89 - 27496.23 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27460.80 - 27503.31 )
Sample Data
σ 708.5163
Minimum 24935.31
Maximum 29305.01
Spread ( max - min ) 4369.70
Range ( max - min ) / 2 2184.85
Range% 7.95
10th Percentile 26354.79
90th Percentile 27802.02
( 90th Percentile - 10th Percentile ) 1447.22
Approx. Iterations needed for
1% dps error 26
0.1% dps error 2658
0.1 scale factor error with delta=300 4462
0.05 scale factor error with delta=300 17848
0.01 scale factor error with delta=300 446218
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 metamorphosis
9 immolation,if=buff.metamorphosis.remains>10
A bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
B immolate,if=!ticking&target.time_to_die>=4&miss_react
C corruption,if=(remains<tick_time|!ticking)&target.time_to_die>=6&miss_react
D fel_flame,if=buff.tier11_4pc_caster.react
E shadowflame
F hand_of_guldan
G incinerate,if=buff.molten_core.react
H soulburn
I soul_fire,if=buff.decimation.react|buff.soulburn.up
J summon_infernal
K life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
L demon_soul
M shadow_bolt
N life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
O fel_flame,moving=1
P life_tap

Sample Sequence

012346789ABCEFHIJLMMMMGGEGFCMMMMMMEMFMMGCGGMEMFGGGMHIMCEKFAMGGGMEMFCGGGMMEMFGG89GCMEMHIFMMMMECGGFGMM6AEMMLMCFMMEMMMDDFMCEMMMMFM89EMCDDMFMEMMAMMCFEMMMGGGGEFGCMMMMEMFMMMCMEMFMMMM6EACMFG89GGELMMMDCDFEMMMMGGGEFCMMMMMEFMMCMMAEGFGGMMMECMFMMMMEG89GFCGMMEMMMFMMCEM6MMAFMMEMCLMDDFMEMMMMCFMEMMMMMFEICIIIIIIE89AFIICI7IIEIIFIIIIIECIIFGGGIIEIIIFCGGGDDEIII6FIAGCEGGGGIFIIEIIICIIFIEIIIIIIICEFI89IIIIIEI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8438 6652 5950
Intellect 5753 5070 4659
Spirit 203 203 20
Health 155860 131038 0
Mana 105968 96323 0
Spell Power 9447 7267 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 27.20% 17.62% 2256
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 17.62% 17.62% 2256
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.87% 13.87% 1053

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 0
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 3
Dark Arts 3
Fel Synergy 2
Demonic Rebirth 2
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 3
Demonic Empowerment 1
Improved Health Funnel 0
Molten Core 3
Hand of Gul'dan 1
Aura of Foreboding 2
Ancient Grimoire 2
Inferno 1
Decimation 2
Cremation 2
Demonic Pact 1
Metamorphosis 1
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Demonology_T11_372
origin="http://chardev.org/?profile=36757"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
glyphs=life_tap/shadow_bolt/immolate/lash_of_pain/metamorphosis
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/metamorphosis
actions+=/immolation,if=buff.metamorphosis.remains>10
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/immolate,if=!ticking&target.time_to_die>=4&miss_react
actions+=/corruption,if=(remains=6&miss_react
actions+=/fel_flame,if=buff.tier11_4pc_caster.react
actions+=/shadowflame
actions+=/hand_of_guldan
actions+=/incinerate,if=buff.molten_core.react
actions+=/soulburn
actions+=/soul_fire,if=buff.decimation.react|buff.soulburn.up
actions+=/summon_infernal
actions+=/life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2256
# gear_mastery_rating=1053
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Destruction_T11_372 : 27965dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27965.0 9.96 / 0.04% 13.2 2117.2 2001.3 mana 0.00% 49.0
Origin http://chardev.org/?profile=36761
Talents http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
Glyphs
  • life_tap
  • immolate
  • imp
  • conflagrate

Charts

http://9.chart.apis.google.com/chart?chs=550x420&cht=bhg&chf=bg,s,333333&chd=t:63633|55181|27701|26944|26360|22277|17029|16033|13448|10855|4692|2530|579&chds=0,127266&chco=9482C9,C41F3B,C41F3B,435133,9482C9,9482C9,C41F3B,9482C9,C41F3B,C41F3B,C41F3B,C79C6E,C79C6E&chm=t++63633++bane_of_doom,9482C9,0,0,15|t++55181++immolate,C41F3B,1,0,15|t++27701++conflagrate,C41F3B,2,0,15|t++26944++fel_flame,435133,3,0,15|t++26360++corruption,9482C9,4,0,15|t++22277++shadowflame,9482C9,5,0,15|t++17029++chaos_bolt,C41F3B,6,0,15|t++16033++shadowburn,9482C9,7,0,15|t++13448++incinerate,C41F3B,8,0,15|t++10855++soul_fire,C41F3B,9,0,15|t++4692++firebolt,C41F3B,10,0,15|t++2530++infernal_melee,C79C6E,11,0,15|t++579++ebon_imp_melee,C79C6E,12,0,15&chtt=Warlock_Destruction_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:17,17,14,13,6,6,6,5,5,4,2,2,1,1,1,1,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,9482C9,C41F3B,C41F3B,9482C9,435133,C79C6E,9482C9,C79C6E,9482C9,C41F3B,C41F3B,C41F3B&chl=firebolt|incinerate|immolate|conflagrate|soul_fire|shadowflame_dot|corruption|burning_embers|chaos_bolt|bane_of_doom|fel_flame|infernal_melee|shadowburn|ebon_imp_melee|shadowflame|infernal_immolation|darkmoon_card_volcano|infernal_awakening&chtt=Warlock_Destruction_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7644333xyzy000zzywwuuvvwwxxvvtssrqqpppqqqstrqqppppprrrrsrrrrrrqppqqqrrpoooooooonooonnmmonnnnnnnnnmnmnnooooooonnnnnmmnmmmmkkjjiihhhhhijjjjjjiihhhhiiijjjjjjijiiiiiiiihhhhgggggggggffffeeedddddddddeeefffffeeeddddddddddddcccbbbabbbbbbbaaaaaaaaaaaaZZZZZZYYYYYYYYYYXXXXXXWXWWXXWWWWWVVVVVVVVWWWXXXXXXXXWXWWWWWWWWWWWWVVVVVVUUUUUVVVVVVVVVVVVWWWWWXXXXXXXXXXXXXXWWWWWWWWWWWWVVVUUUUTTTTUUUVVWWWWWWWWWWWWWWWWWWWWWWWWWWVVVVVVVVVVWWWWWWXXXXXXYYYYYXYYYYYYZZZZYYYYYYYYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105785&chtt=Warlock_Destruction_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:elmmnorruwwz1123457765111110zxttsrrrrqqppoppoonllkjjjklkjiiggggffedddeeeedbaaccddcccccddedddddeefffgggghgghhhghhhijjjihhgghhhhhhhhijjjihhhhhiiihhhhiiihhggffffffeeeeedccccccbbccddcccbbccdddddeeffffeeeeeeffffffffffffeeeeffggghhhgghhhhhgghhiiiiihhhhhhhhhhhhhgggffeeeeeeeeeddddddddddeefffggggffffffeeffffeedddccccccdddeeffffgghhiiijjjkkkkkjjjiiihhhgggffeeeedddddeeeeeeeeeffgghhiijjjjjiiiihhhhhhgggffeeedddddddeeeeeefffggghhiijjjjjjjjjjjjjiiiiihhgggggfgffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27965|max=50128&chxp=1,1,56,100&chtt=Warlock_Destruction_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,1,7,8,15,23,37,59,68,97,152,199,246,291,365,416,481,513,547,655,603,598,631,580,514,454,424,384,330,252,230,201,146,131,95,67,66,38,22,16,8,7,7,5,3,1,1,1,2&chds=0,655&chbh=5&chxt=x&chxl=0:|min=26177|avg=27965|max=29808&chxp=0,1,49,100&chtt=Warlock_Destruction_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Destruction_T11_372 27965
bane_of_doom 1237 4.4% 7.7 60.05sec 72435 63633 0 0 0 0.0% 1.6% 0.0% 0.0% 29 15245 31577 25.1% 0.0% 95.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.73 7.73 28.93 28.93 1.1383 15.0000 559760
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.42% 0.00 0 0 0
miss 0.1 1.58% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.7 74.88% 15244.79 12416 20824 330298
crit 7.3 25.12% 31576.77 25514 42791 229462

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
burning_embers 1399 5.0% 331.0 1.36sec 1913 0 0 0 0 24.6% 1.5% 0.0% 0.0% 448 1413 0 0.0% 0.0% 99.1%

Stats details: burning_embers

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
330.95 330.95 448.08 448.08 0.0000 1.0000 633032
Direct Results Count Pct Average Min Max Total Damage
hit 244.5 73.88% 0.00 0 0 0
crit 81.4 24.60% 0.00 0 0 0
miss 5.1 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 448.1 100.00% 1412.75 260 2158 633032

Action details: burning_embers

Static Values
  • id:85421
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:Your Soulfire and your Imp's Firebolt cause a Burning Ember damage-over-time effect on the target equal to a percentage of the damage done lasting $85421d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1555.18
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
chaos_bolt 1372 4.9% 31.1 14.57sec 19956 17029 15319 32125 43913 29.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.09 30.94 0.00 0.00 1.1718 0.0000 620445
Direct Results Count Pct Average Min Max Total Damage
hit 21.3 68.92% 15319.15 12102 22125 326699
crit 9.1 29.55% 32124.82 26360 43913 293746
miss 0.5 1.52% 0.00 0 0 0

Action details: chaos_bolt

Static Values
  • id:50796
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a bolt of chaotic fire at the enemy, dealing $s1 Fire damage. Chaos Bolt cannot be resisted, and pierces through all absorption effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1311.57
  • base_dd_max:1665.89
conflagrate 3637 13.0% 51.9 8.75sec 31693 27701 22597 46564 75123 39.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.91 51.91 0.00 0.00 1.1441 0.0000 1645312
Direct Results Count Pct Average Min Max Total Damage
hit 30.7 59.11% 22596.97 18565 36559 693370
crit 20.4 39.38% 46563.88 38149 75123 951943
miss 0.8 1.51% 0.00 0 0 0

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3288.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly deals fire damage equal to $s2% of your Immolate's periodic damage on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:10510.96
  • base_dd_max:10510.96
corruption 1678 6.0% 25.2 18.11sec 30080 26360 0 0 0 0.0% 1.6% 0.0% 0.0% 199 3000 6217 25.1% 0.0% 98.3%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.24 25.24 199.44 199.44 1.1411 2.2299 759267
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 98.43% 0.00 0 0 0
miss 0.4 1.57% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 149.4 74.91% 2999.73 2430 4271 448164
crit 50.0 25.09% 6217.50 4994 8776 311103

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 109 0.4% 10.3 45.95sec 4799 0 4243 6560 7585 26.9% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.27 10.27 0.00 0.00 0.0000 0.0000 49284
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 71.48% 4243.43 3817 4916 31150
crit 2.8 26.92% 6560.15 5898 7585 18134
miss 0.2 1.61% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 509 1.8% 7.5 37.65sec 30800 26944 24691 51245 75581 24.7% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.48 7.46 0.00 0.00 1.1431 0.0000 230456
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 73.80% 24690.73 20162 36782 136006
crit 1.8 24.69% 51244.71 41429 75581 94449
miss 0.1 1.51% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
immolate 3836 13.7% 26.9 16.96sec 64610 55181 6372 13326 18658 30.5% 1.5% 0.0% 0.0% 200 5637 11836 31.1% 0.0% 98.8%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.85 26.85 199.54 199.54 1.1709 2.2404 1735065
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 68.00% 6371.56 5371 9080 116347
crit 8.2 30.49% 13326.37 11036 18658 109132
miss 0.4 1.51% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 137.5 68.89% 5636.77 4725 8142 774865
crit 62.1 31.11% 11836.00 9709 16731 734721

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 4636 16.6% 119.9 3.69sec 17496 13448 13379 28306 40968 29.5% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
119.86 119.33 0.00 0.00 1.3011 0.0000 2097067
Direct Results Count Pct Average Min Max Total Damage
hit 82.4 69.01% 13378.85 10901 19937 1101803
crit 35.2 29.47% 28305.91 22808 40968 995264
miss 1.8 1.52% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
infernal_awakening 59 0.2% 1.0 0.00sec 26888 0 20935 43040 43854 28.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_awakening

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 26888
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 70.07% 20934.90 15922 23049 14669
crit 0.3 28.39% 43040.24 32717 43854 12219
miss 0.0 1.54% 0.00 0 0 0

Action details: infernal_awakening

Static Values
  • id:22703
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:An infernal falls from the sky, dealing $s1 Fire damage to all targets, stunning them for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.765000
  • base_dd_min:438.73
  • base_dd_max:494.74
shadowburn 222 0.8% 5.4 17.52sec 18613 16033 14850 30845 42940 25.0% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.40 5.40 0.00 0.00 1.1609 0.0000 100549
Direct Results Count Pct Average Min Max Total Damage
hit 4.0 73.46% 14849.76 11833 20897 58927
crit 1.3 24.98% 30844.66 24316 42940 41622
miss 0.1 1.56% 0.00 0 0 0

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly blasts the target for $17877s2 Shadow damage. If the target dies within $29341d of Shadowburn, and yields experience or honor, the caster gains $29341s1 Soul Shards. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.056000
  • base_dd_min:649.32
  • base_dd_max:724.90
shadowflame 1900 6.8% 33.7 13.48sec 25510 22277 2162 4469 5721 24.6% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.69 33.69 0.00 0.00 1.1452 0.0000 90864
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.85% 2162.49 1848 2780 53798
crit 8.3 24.62% 4469.25 3797 5721 37066
miss 0.5 1.53% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1699 6.1% 33.7 13.48sec 22813 0 0 0 0 24.7% 1.5% 0.0% 0.0% 134 4502 9340 25.1% 0.0% 44.5%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.69 33.69 134.45 134.45 0.0000 1.4989 768540
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.77% 0.00 0 0 0
crit 8.3 24.70% 0.00 0 0 0
miss 0.5 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.7 74.90% 4502.14 3647 6414 453386
crit 33.7 25.10% 9339.67 7494 13179 315154

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1807 6.5% 39.1 11.43sec 20895 10855 16017 33522 46363 29.7% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.12 38.97 0.00 0.00 1.9248 0.0000 817393
Direct Results Count Pct Average Min Max Total Damage
hit 26.8 68.77% 16016.82 13668 22563 429291
crit 11.6 29.71% 33521.78 28085 46363 388102
miss 0.6 1.52% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 45.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - imp 4688
firebolt 4688 100.0% 300.2 1.51sec 7061 4692 5697 11476 17135 26.3% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
300.23 298.58 0.00 0.00 1.5051 0.0000 2119997
Direct Results Count Pct Average Min Max Total Damage
hit 214.2 71.73% 5697.41 4983 8589 1220187
crit 78.4 26.26% 11476.10 9942 17135 899810
miss 6.0 2.01% 0.00 0 0 0

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:632.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $ Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.649000
  • base_dd_min:111.86
  • base_dd_max:124.88
pet - infernal 5712
infernal_immolation 1520 26.6% 1.0 0.00sec 80879 339573066 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3751 0 0.0% 2.0% 0.0%

Stats details: infernal_immolation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 22.00 0.0002 0.0000 80879
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.6 98.00% 3751.30 2829 3825 80879
miss 0.4 2.00% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:20153
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.400000
  • base_dd_min:42.50
  • base_dd_max:42.50

Action details: infernal_immolation

Static Values
  • id:19483
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
  • description:Burns nearby enemies for $20153s1 fire damage every $t1 seconds.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
infernal_melee 4192 73.4% 82.0 0.53sec 2721 2530 2700 5401 5472 21.3% 14.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: infernal_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.99 81.99 0.00 0.00 1.0755 0.0000 223128
Direct Results Count Pct Average Min Max Total Damage
hit 32.9 40.11% 2700.06 2249 2736 88791
crit 17.5 21.34% 5401.02 4497 5472 94491
glance 19.7 24.00% 2025.12 1687 2052 39846
dodge 5.4 6.55% 0.00 0 0 0
miss 6.6 8.01% 0.00 0 0 0

Action details: infernal_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - ebon_imp 232
ebon_imp_melee 232 100.0% 116.7 0.70sec 792 579 822 1644 1644 16.9% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
116.68 116.68 0.00 0.00 1.3688 0.0000 92464
Direct Results Count Pct Average Min Max Total Damage
hit 52.1 44.65% 822.05 822 822 42823
crit 19.7 16.87% 1644.11 1644 1644 32354
glance 28.0 24.03% 616.54 617 617 17286
dodge 7.6 6.47% 0.00 0 0 0
miss 9.3 7.98% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Destruction_T11_372
bane_of_doom mana 2.5% 23.5 3082
chaos_bolt mana 4.7% 13.9 1438
conflagrate mana 17.8% 9.6 3288
corruption mana 3.2% 24.4 1233
demon_soul mana 1.1% 0.0 2368
fel_flame mana 1.0% 25.0 1233
immolate mana 4.6% 39.3 1644
incinerate mana 36.0% 6.1 2877
infernal mana 1.7% 0.0 16442
shadowburn mana 1.7% 6.0 3082
shadowflame mana 18.1% 5.0 5138
soul_fire mana 7.6% 11.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - imp
firebolt mana 100.0% 11.2 632
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1809.9 29404.4 16.2 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 99788.0 99788.0 0.0%
life_tap mana 0.6 16713.5 27480.2 0.0%
mana_feed mana 78.4 364726.0 4651.7 0.2%
mp5_regen mana 1809.9 92621.1 51.2 0.3%
replenishment mana 1809.9 52264.1 28.9 0.3%
soul_leech mana 74.2 343746.3 4634.7 0.2%
pet - imp mana
initial_mana none 1.0 74772.5 74772.5 0.0%
mana_feed mana 0.6 69.2 113.8 99.3%
mana_spring_totem mana 1809.9 8156.8 4.5 72.4%
mp5_regen mana 1809.9 171615.8 94.8 65.7%
replenishment mana 1809.9 9790.7 5.4 72.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 33.8 17.4 13.5sec 8.9sec 81% 84%

Database details

  • id:54277
  • cooldown name:buff_backdraft
  • tooltip:Reduced cast time for your Shadow Bolt, Incinerate and Chaos Bolt by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bell_of_enraging_resonance 4.8 0.0 103.8sec 103.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 205.8 0.0 2.2sec 2.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.3 0.0 45.9sec 45.9sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_imp 4.3 0.0 120.7sec 120.7sec 19% 17%

Database details

  • id:79459
  • cooldown name:buff_demon_soul_imp
  • tooltip:Critical strike chance of your cast time Destruction spells increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
empowered_imp 11.3 0.4 36.1sec 34.9sec 5% 7%

Database details

  • id:47283
  • cooldown name:buff_empowered_imp
  • tooltip:Soulfire is instant cast.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:4.00%
improved_soul_fire 7.3 31.1 60.7sec 11.6sec 95% 94%

Database details

  • id:85383
  • cooldown name:buff_improved_soul_fire
  • tooltip:Shadow and Fire damage increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.6sec 46.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 45.7sec 45.7sec 0% 2%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.2 86.4sec 80.9sec 6% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.1sec 363.1sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
imp-bloodlust 1.0 0.0 0.0sec 0.0sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
imp-casting 301.2 0.0 1.5sec 1.5sec 95% 95%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 15.4%
backdraft_1 21.8%
backdraft_2 29.7%
backdraft_3 33.1%

Procs

Count Interval
ebon_imp 5.8 64.0sec
empowered_imp 11.7 34.9sec

Statistics & Data Analysis

DPS
Population
Convergence 66.97%
σ of the average dps 4.9805
2 * σ / μ 0.0356%
95% Confidence Intervall ( μ ± 2σ ) ( 27955.09 - 27975.01 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27950.10 - 27979.99 )
Sample Data
σ 498.0520
Minimum 26176.63
Maximum 29808.22
Spread ( max - min ) 3631.59
Range ( max - min ) / 2 1815.80
Range% 6.49
10th Percentile 27218.72
90th Percentile 28442.86
( 90th Percentile - 10th Percentile ) 1224.14
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1268
0.1 scale factor error with delta=300 2204
0.05 scale factor error with delta=300 8819
0.01 scale factor error with delta=300 220494
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_imp
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 soulburn,if=buff.bloodlust.down
A soul_fire,if=buff.soulburn.up
B fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
C immolate,if=(remains<cast_time+gcd|!ticking)&target.time_to_die>=4&miss_react
D conflagrate
E bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
F corruption,if=(!ticking|dot.corruption.remains<tick_time)&miss_react
G shadowflame
H soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
I chaos_bolt
J summon_infernal
K soulburn,if=buff.bloodlust.down
L soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
M shadowburn
N incinerate
O life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
P fel_flame,moving=1
Q life_tap

Sample Sequence

01234678CDEFGIJLNDNNNNCNGDIFLNNNDNCGNNINDLFN9ANCDGINNNLDNFGCINDELNNNDGIFCNLDNNNG9AIDNCFNNLDGHINNNCDNFGLIDNNN68NCEDGLF9AIDNNNNBBCDGIFLNDNNNNCGDILFNNDNNGCILDNNNNEFDGCILNDNNNGNFDCILNNDGNNNNFCDILGNNDNNNNCFD68GILENDNNNNCGDFILNNDNNGCNIDLFNNGDNNCILDNNFGNNDILCNEDGNNFILDNCNGHNDINNNFLCDGNINQNDLFGCHDINNNN68DGLECFDINNNGLDNNCIFNDGLNNNDICNNGFDLNBINDBGNNLDFICENGDHL7MNIDNCFGNLQDMINNNGCDFLNIMDNGNNCLDFIN68MGNDNELCIDHFGMNNDNNICLDGNMFNNDILCGNDNMNNFIDGL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5731 5049 4639
Spirit 203 203 20
Health 152668 128504 0
Mana 105638 96008 0
Spell Power 9423 7246 2207
Spell Hit 15.47% 15.47% 1585
Spell Crit 20.66% 14.61% 919
Spell Haste 30.05% 20.25% 2593
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 13.20% 13.20% 1585
Melee Crit 16.14% 8.19% 919
Melee Haste 20.25% 20.25% 2593
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.97% 12.97% 891

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 3
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 2
Backdraft 3
Shadowburn 1
Burning Embers 2
Soul Leech 2
Backlash 0
Nether Ward 1
Fire and Brimstone 3
Shadowfury 1
Nether Protection 2
Empowered Imp 2
Bane of Havoc 1
Chaos Bolt 1

Profile

#!./simc

warlock=Warlock_Destruction_T11_372
origin="http://chardev.org/?profile=36761"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
glyphs=life_tap/immolate/imp/conflagrate
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_imp
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.soulburn.up
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
actions+=/immolate,if=(remains=4&miss_react
actions+=/conflagrate
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/corruption,if=(!ticking|dot.corruption.remains actions+=/shadowflame
actions+=/soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
actions+=/chaos_bolt
actions+=/summon_infernal
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
actions+=/shadowburn
actions+=/incinerate
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4639
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1585
# gear_crit_rating=919
# gear_haste_rating=2593
# gear_mastery_rating=891
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warrior_Arms_T11_372 : 27535dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27534.7 16.05 / 0.06% 2714.6 10.1 10.2 rage 7.35% 50.3
Origin http://chardev.org/?profile=36399
Talents http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
Glyphs
  • thunder_clap
  • cleaving
  • sweeping_strikes
  • battle
  • berserker_rage
  • intimidating_shout
  • slam
  • overpower
  • mortal_strike

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:32020|24878|19911|17910|16708|8917|3236&chds=0,64041&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++32020++overpower,C79C6E,0,0,15|t++24878++execute,C79C6E,1,0,15|t++19911++slam,C79C6E,2,0,15|t++17910++mortal_strike,C79C6E,3,0,15|t++16708++rend,C79C6E,4,0,15|t++8917++colossus_smash,C79C6E,5,0,15|t++3236++melee_main_hand,C79C6E,6,0,15&chtt=Warrior_Arms_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:20,19,11,10,10,8,6,6,5,4&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E&chl=overpower|mortal_strike|slam_mh|melee_main_hand|opportunity_strike|deep_wounds|execute|rend_dot|heroic_strike|colossus_smash&chtt=Warrior_Arms_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:agbhbhlq4457875uqjlifdZddcZabZWYZaaXWYZbaZbXYXTUUUTSRRSSRRTRRVVWXWXXVXXWXXWWUVUUUTTTSSSSTSSTTUUSSSRRRQRRSRRSRRRQQRPQQPQRQRSTUVXZdgjnsuxxvspljhfedbaZZYYYXYYXXXVWVVVUUVUUUUUUTTTTSSSRSSSSUTUUTTTSSSSRSSSSSRRSRRSRRSRSSSTUUUUUTTUTTTTTTSTTTTTTTTTTTTSTTUVWXZbcfhjlmnmmkjhgfedcbaZYXXXXXXWWWVVVUUUUUUUTUUTUUTTUTTTTTUUVWWWWWWVUUUTTTTSSSRSSRSSRRSRSSSSTTSSSSTSSTTSSSSSTSTTTTTSSTTTUUUVVWWXYZZZaaaaZZZZYYYYXXXWXWWWWWWWVVVVVVUUUUUTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Warrior_Arms_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:3444557654466777751240xwwvurqrrrqppppooomllllkjjijjhhgggfffeeeeffffffgfffffffffffffffffffeeeeefffffffgfffgggggghhhiijjkkkkkllmmmnnnoononnnmmmmlmllllllllkkkkkkkkkkkkjjjiihhhgggggggfffffffffefefffffffffeeeeffffffggggghhhhhhhhiiiiiiiiiiihhihiiiiiiijjjjjjjjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkjjjjjiiiiihhhhhhhhhhiiiiiiijjjjjjjkkkkkkkkkkkkllllllllllllllllllllkkkkkkkkkkkkkkkkklllllllllmmmmmmmnnnnoooppppqqqrrrsssssssssrrrrrqqqqqqqqqpqqqqqqqrrrrrrrrrrrrrrrrrrrr&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27535|max=44259&chxp=1,1,62,100&chtt=Warrior_Arms_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,1,3,5,8,16,22,35,53,73,116,141,170,183,256,355,406,479,517,549,570,617,630,606,611,521,493,462,409,348,315,256,201,128,126,81,65,46,38,27,14,12,11,9,5,2,4,1,1&chds=0,630&chbh=5&chxt=x&chxl=0:|min=24605|avg=27535|max=30788&chxp=0,1,47,100&chtt=Warrior_Arms_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Arms_T11_372 27535
battle_shout 0 0.0% 5.5 76.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.48 5.48 0.00 0.00 1.5144 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 15.2 30.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.17 15.17 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
colossus_smash 1103 4.0% 37.0 12.27sec 13495 8917 11219 23608 40961 21.4% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.98 36.98 0.00 0.00 1.5135 0.0000 499105
Direct Results Count Pct Average Min Max Total Damage
hit 27.9 75.32% 11219.02 8858 19884 312523
crit 7.9 21.37% 23608.44 18248 40961 186582
dodge 1.2 3.31% 0.00 0 0 0

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
deadly_calm 0 0.0% 3.5 128.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.52 3.52 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:-0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Abilities cost no rage.
  • description:For the next $d, none of your abilities cost rage, but you continue to generate rage. Cannot be used during Inner Rage.
deep_wounds 2261 8.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 430 2377 0 0.0% 0.0% 95.1%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 173.39 430.35 430.35 0.0000 1.0000 1022783
Direct Results Count Pct Average Min Max Total Damage
hit 173.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 430.4 100.00% 2376.61 755 9693 1022783

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2555.12
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1699 6.2% 20.4 4.35sec 37597 24878 31191 57813 135706 27.9% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.44 20.44 0.00 0.00 1.5113 0.0000 768460
Direct Results Count Pct Average Min Max Total Damage
hit 14.1 68.83% 31190.59 634 65877 438792
crit 5.7 27.90% 57813.04 42 135706 329667
dodge 0.7 3.27% 0.00 0 0 0

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 1496 5.4% 39.2 11.31sec 17258 0 12604 27278 48604 34.5% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.19 39.19 0.00 0.00 0.0000 0.0000 676424
Direct Results Count Pct Average Min Max Total Damage
hit 24.4 62.18% 12604.09 8205 23197 307193
crit 13.5 34.54% 27278.09 16903 48604 369231
dodge 1.3 3.28% 0.00 0 0 0

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 2788 10.1% 128.8 3.53sec 9795 3236 8876 18292 29783 18.5% 3.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
128.76 128.76 0.00 0.00 3.0265 0.0000 1261165
Direct Results Count Pct Average Min Max Total Damage
hit 69.8 54.18% 8875.95 6278 14826 619164
crit 23.8 18.52% 18291.64 12933 29783 436162
glance 30.9 24.00% 6661.66 4709 10843 205839
dodge 4.3 3.31% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 5302 19.3% 88.0 5.15sec 27240 17910 20113 45826 74735 30.3% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.04 88.04 0.00 0.00 1.5209 0.0000 2398188
Direct Results Count Pct Average Min Max Total Damage
hit 58.4 66.33% 20113.10 12083 32894 1174585
crit 26.7 30.33% 45826.12 27454 74735 1223603
dodge 2.9 3.34% 0.00 0 0 0

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:Healing effects received reduced by $s1%.
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and wounds the target, reducing the effectiveness of any healing received by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:423.09
  • base_dd_max:423.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
opportunity_strike 2702 9.8% 127.5 3.54sec 9588 0 8010 16836 27651 20.9% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.45 127.45 0.00 0.00 0.0000 0.0000 1222021
Direct Results Count Pct Average Min Max Total Damage
hit 96.6 75.77% 8009.96 5790 13078 773531
crit 26.6 20.90% 16836.32 11928 27651 448489
dodge 4.2 3.33% 0.00 0 0 0

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
overpower 5528 20.1% 77.0 5.81sec 32456 32020 16040 36762 58727 79.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.04 77.04 0.00 0.00 1.0136 0.0000 2500422
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 20.78% 16039.89 8787 25848 256821
crit 61.0 79.22% 36762.20 19616 58727 2243601

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:5.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly overpower the enemy, causing $m1% weapon damage. Only useable after the target dodges. The Overpower cannot be blocked, dodged or parried.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
recklessness 0 0.0% 2.0 363.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
rend 1651 6.0% 29.5 15.45sec 25349 16708 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.45 29.45 0.00 0.00 1.5171 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 29.5 100.00% 0.00 0 0 0

Action details: rend

Static Values
  • id:772
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Wounds the target causing them to bleed for $94009o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $94009d.
rend_dot 1651 6.0% 29.5 15.45sec 25349 0 0 0 0 0.0% 3.3% 0.0% 0.0% 168 3611 7457 21.6% 0.0% 92.5%

Stats details: rend_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
29.45 29.45 168.00 168.00 0.0000 2.4915 746540
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 96.69% 0.00 0 0 0
dodge 1.0 3.31% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.6 78.35% 3611.06 1494 4902 475353
crit 36.4 21.65% 7456.97 3077 10099 271187

Action details: rend_dot

Static Values
  • id:94009
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:Wounds the target causing them to bleed for $o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:2094.17
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slam 3004 10.9% 45.1 7.87sec 30110 19911 0 0 0 0.0% 3.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.13 45.13 0.00 0.00 1.5122 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 43.6 96.63% 0.00 0 0 0
dodge 1.5 3.37% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 3004 10.9% 43.6 8.14sec 31159 0 23817 54234 89504 24.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.61 43.61 0.00 0.00 0.0000 0.0000 1358870
Direct Results Count Pct Average Min Max Total Damage
hit 33.1 75.86% 23816.78 14805 39394 787964
crit 10.5 24.14% 54233.57 33636 89504 570906

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:-1.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Arms_T11_372
colossus_smash rage 14.7% 739.6 18
execute rage 11.6% 1445.6 26
heroic_strike rage 10.7% 1384.3 12
mortal_strike rage 35.2% 1485.4 18
overpower rage 7.7% 7043.9 5
rend rage 5.8% 2819.5 9
slam rage 13.5% 2191.6 14
Resource Gains Type Count rage Average Overflow
anger_management rage 1809.9 147.3 0.1 2.3%
avoided_attacks rage 5.7 90.4 15.8 0.0%
battle_shout rage 5.5 109.6 20.0 0.0%
berserker_rage rage 15.2 75.9 5.0 0.0%
blood_frenzy rage 12.4 235.9 19.0 5.2%
melee_main_hand rage 128.8 3880.0 30.1 2.4%
sudden_death rage 10.2 81.0 8.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 3.0 0.0 183.6sec 362.6sec 99% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 12.8 0.0 32.8sec 32.8sec 5% 6%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 15.2 0.0 30.8sec 30.8sec 33% 33%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance 2.0 0.0 365.3sec 365.3sec 1% 100%

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.3sec 123.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
colossus_smash 29.4 6.3 15.5sec 12.7sec 47% 41%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_calm 3.5 0.0 128.1sec 128.1sec 8% 7%

Database details

  • id:
  • cooldown name:buff_deadly_calm
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
executioner_talent 2.5 17.3 35.6sec 4.5sec 19% 39%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.2sec 339.2sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 3.4 0.0 102.9sec 102.9sec 2% 9%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
inner_rage 4.4 0.0 96.8sec 96.8sec 15% 15%

Database details

  • id:1134
  • cooldown name:buff_inner_rage
  • tooltip:Heroic Strike and Cleave cooldown reduced.
  • max_stacks:1
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
lambs_to_the_slaughter 1.1 84.0 243.8sec 5.3sec 100% 99%

Database details

  • id:
  • cooldown name:buff_lambs_to_the_slaughter
  • tooltip:(null)
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 14.2 25.0 31.9sec 11.3sec 65% 66%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overpower 14.8 0.5 29.4sec 28.3sec 5% 18%

Database details

  • id:
  • cooldown name:buff_overpower
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:1.00
  • default_chance:100.00%
recklessness 2.0 0.0 363.8sec 363.8sec 5% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
taste_for_blood 70.1 2.8 6.4sec 6.2sec 29% 91%

Database details

  • id:
  • cooldown name:buff_taste_for_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:9.00
  • cooldown:5.00
  • default_chance:100.00%
tier11_4pc_melee 2.0 75.0 370.6sec 5.8sec 96% 94%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
wrecking_crew 13.5 13.2 34.2sec 16.8sec 55% 54%

Database details

  • id:
  • cooldown name:buff_wrecking_crew
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 2.3%

Procs

Count Interval
munched_deep_wounds 29.5 15.5sec
rolled_deep_wounds 31.2 15.0sec
strikes_of_opportunity 127.5 3.5sec
sudden_death 36.2 12.5sec

Statistics & Data Analysis

DPS
Population
Convergence 70.96%
σ of the average dps 8.0273
2 * σ / μ 0.0583%
95% Confidence Intervall ( μ ± 2σ ) ( 27518.68 - 27550.79 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27510.65 - 27558.81 )
Sample Data
σ 802.7342
Minimum 24604.83
Maximum 30788.42
Spread ( max - min ) 6183.60
Range ( max - min ) / 2 3091.80
Range% 11.23
10th Percentile 26544.12
90th Percentile 28577.98
( 90th Percentile - 10th Percentile ) 2033.86
Approx. Iterations needed for
1% dps error 33
0.1% dps error 3399
0.1 scale factor error with delta=300 5727
0.05 scale factor error with delta=300 22911
0.01 scale factor error with delta=300 572784
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
6 stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
7 recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
8 berserker_rage,if=!buff.deadly_calm.up&rage<70
9 deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
A sweeping_strikes,if=target.adds>0
B bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
C cleave,if=target.adds>0
D inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
E heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
F overpower,if=buff.taste_for_blood.remains<=1.5
G mortal_strike,if=target.health_pct>20|rage>=30
H execute,if=buff.battle_trance.up
I rend,if=!ticking
J colossus_smash,if=buff.colossus_smash.remains<0.5
K execute,if=(buff.deadly_calm.up|buff.recklessness.up)
L mortal_strike
M overpower
N execute
O slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
P battle_shout,if=rage<20

Sample Sequence

013458P7GJ69EIGEMJEGMODEJGMOIGEJMGOM8GOIGEJMGMOGMOIGJMGOM8PDEGJOGIJMMGOJMGOMGIFIG8JMGEMJGMOIGMJDEGOMFGOIG8JMGMO9EJGEMOIEGMODEGJMEGOPGIE8JGMOMGJMDEGOIGMJGOMGJI8GMOGEMOGMOIFGIJMGOMPGO8MGIGMEOJMEGEOGIMJMGO8MGEO9EGIEMGEOMDJEGOOGMIGMO8GEOMPEGJIGEMOGMJGMOJEFGIJ8GEMOMEGMIGEMOGJMGOIG8JMGDEMJGMOJGIMJGOMPGJMG8IJGMO9EGJEMGEOIEGDMODEGDEMJEGMO8IGMOGEOJMEIGMJGPMGMO8IGMEFGEOM57J6GKKGIJKGEMJNGM8NNGEIJGMNFGJMNNGIJLMNEMG8NNEMPGINGMJNGMNFLIMNLNM8NNGJMIGENMNGEJMNGNIG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6261 4977 4548
Agility 729 145 20
Stamina 7658 6035 5862
Intellect 55 53 20
Spirit 82 82 20
Health 150167 127515 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.59% 9.59% 982
Spell Crit 20.36% 15.36% 2575
Spell Haste 11.23% 5.93% 760
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14215 10354 190
Melee Hit 8.18% 8.18% 982
Melee Crit 23.36% 15.96% 2575
Melee Haste 5.93% 5.93% 760
Expertise 12.69 12.69 381
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.02% 15.02% 1259

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 2
Taste for Blood 3
Sweeping Strikes 1
Impale 2
Improved Hamstring 0
Improved Slam 2
Deadly Calm 1
Blood Frenzy 2
Lambs to the Slaughter 3
Juggernaut 1
Sudden Death 2
Wrecking Crew 2
Throwdown 1
Bladestorm 1
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 0
Rude Interruption 0
Piercing Howl 0
Flurry 0
Death Wish 0
Enrage 0
Die by the Sword 0
Raging Blow 0
Rampage 0
Heroic Fury 0
Furious Attacks 0
Meat Cleaver 0
Intensify Rage 0
Bloodsurge 0
Skirmisher 0
Titan's Grip 0
Single-Minded Fury 0
Protection Rank
Incite 1
Toughness 0
Blood and Thunder 2
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Arms_T11_372
origin="http://chardev.org/?profile=36399"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
glyphs=thunder_clap/cleaving/sweeping_strikes/battle/berserker_rage/intimidating_shout/slam/overpower/mortal_strike
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
actions+=/recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/berserker_rage,if=!buff.deadly_calm.up&rage<70
actions+=/deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
actions+=/sweeping_strikes,if=target.adds>0
actions+=/bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
actions+=/cleave,if=target.adds>0
actions+=/inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
actions+=/heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
actions+=/overpower,if=buff.taste_for_blood.remains<=1.5
actions+=/mortal_strike,if=target.health_pct>20|rage>=30
actions+=/execute,if=buff.battle_trance.up
actions+=/rend,if=!ticking
actions+=/colossus_smash,if=buff.colossus_smash.remains<0.5
actions+=/execute,if=(buff.deadly_calm.up|buff.recklessness.up)
actions+=/mortal_strike
actions+=/overpower
actions+=/execute
actions+=/slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
actions+=/battle_shout,if=rage<20
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4548
# gear_agility=20
# gear_stamina=5862
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=381
# gear_hit_rating=982
# gear_crit_rating=2575
# gear_haste_rating=760
# gear_mastery_rating=1259
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_1h_T11_372 : 27994dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27993.7 18.24 / 0.07% 2215.4 12.6 12.7 rage 8.50% 46.0
Origin http://chardev.org/?profile=36557
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • battle
  • berserker_rage
  • bloody_healing
  • slam
  • raging_blow
  • bloodthirst

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:24737|23458|20967|17117|7260|3790|2356&chds=0,49475&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++24737++execute,C79C6E,0,0,15|t++23458++slam,C79C6E,1,0,15|t++20967++bloodthirst,C79C6E,2,0,15|t++17117++raging_blow,C79C6E,3,0,15|t++7260++colossus_smash,C79C6E,4,0,15|t++3790++melee_main_hand,C79C6E,5,0,15|t++2356++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:34,14,10,8,7,6,6,6,4,4,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|heroic_strike|melee_off_hand|slam_mh|deep_wounds|execute|raging_blow_mh|slam_oh|raging_blow_oh|colossus_smash&chtt=Warrior_Fury_1h_T11_372+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:cpoYafZenkosquzwz1y0312upmljjnw135668767643yrleeeafggjlkmomprruwrojbeebhkknporsrtusuurohbcbZdghjlmoqqsuuvvtpjedccehikmmopqrstttsoiecccehjlnoprssroopolgcaaabeghjklnoprrssrnjecccegjlnopqrrstttsokfdddegikmnpqrsstutspkgdccdfiklmopqrstttspkgdccdfiklnopqsttttrokgedddfijlmopqrstttsplhedcdfhjlmoomklmnnmliecbabdeghjklmnooppomkgedddfgijkmnoppqqqpoligfeefhiklmnoopqqqqomjhgffghiklmmnoppqqpomkiggfghijklmnnoppppomljhggghijlmmnoopppponmkjihhijjjhhijkkllmnmmlkjjjk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Warrior_Fury_1h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:74542331110223100yyywuutstsrrqpppoomkkihhhggfeeeddcbbaaaZaaZZaZZaZaaZaaZaaZaaZaaZaaZaZZaZZZZZaZaaaabbbbccccdddeeeefffffffeeeeeeddddccccccccdddeffgghhiijjkkllllllkkjjihhggffeeddccbbbaaaZZZZZZZZZZZaaaaaaaaabbbcccdddddeeeeeeffffeeeeeeeeeeffffffggggfffffffeedddcccbbbbbbcccdddeeeeffffgggggggggffffffffffffffffffggggggggggggggggggggffffffeeeeeeeddddddcccccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbccccdddeeeffggghhhiiiiiiiiiiihhhhhhhhhhhhhiiijjjkkkkkklllllmmmmmnnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27994|max=52548&chxp=1,1,53,100&chtt=Warrior_Fury_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,1,2,4,9,11,11,23,27,51,61,74,92,158,180,227,303,356,389,450,500,525,548,580,644,586,584,527,529,444,412,359,268,220,201,167,120,97,84,48,42,26,19,14,9,5,3,2,3,2&chds=0,644&chbh=5&chxt=x&chxl=0:|min=24638|avg=27994|max=31455&chxp=0,1,49,100&chtt=Warrior_Fury_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T11_372 27994
battle_shout 0 0.0% 12.2 36.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.24 12.24 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 6.9 55.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 9488 33.9% 134.9 3.34sec 31815 20967 23356 48722 106987 33.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.90 134.90 0.00 0.00 1.5174 0.0000 4291838
Direct Results Count Pct Average Min Max Total Damage
hit 89.9 66.65% 23356.42 14404 51936 2100025
crit 45.0 33.35% 48722.34 29672 106987 2191813

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 531 1.9% 21.9 21.10sec 10981 7260 8745 18270 28058 23.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.89 21.89 0.00 0.00 1.5125 0.0000 240345
Direct Results Count Pct Average Min Max Total Damage
hit 16.8 76.53% 8745.02 6477 13621 146483
crit 5.1 23.47% 18269.86 13343 28058 93861

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 1639 5.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 434 1709 0 0.0% 0.0% 95.9%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 209.96 433.71 433.71 0.0000 1.0000 741340
Direct Results Count Pct Average Min Max Total Damage
hit 210.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 433.7 100.00% 1709.30 302 7950 741340

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1631.85
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1623 5.8% 19.6 4.58sec 37373 24737 30340 62072 133098 22.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.64 19.64 0.00 0.00 1.5108 0.0000 734119
Direct Results Count Pct Average Min Max Total Damage
hit 15.3 77.84% 30340.32 1844 64611 463876
crit 4.4 22.16% 62072.00 14909 133098 270243

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2868 10.2% 55.5 7.99sec 23369 0 15934 32823 69783 44.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.53 55.53 0.00 0.00 0.0000 0.0000 1297576
Direct Results Count Pct Average Min Max Total Damage
hit 31.1 55.98% 15933.99 9399 33875 495268
crit 24.4 44.02% 32822.82 19362 69783 802308

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3785 13.5% 262.0 1.73sec 6534 3790 6749 13904 27413 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.04 262.04 0.00 0.00 1.7242 0.0000 1712305
Direct Results Count Pct Average Min Max Total Damage
hit 96.5 36.83% 6749.20 4409 13307 651318
crit 53.4 20.39% 13904.00 9082 27413 742726
glance 62.8 23.98% 5063.99 3307 9981 318261
miss 49.3 18.80% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2353 8.4% 261.4 1.73sec 4072 2356 4207 8671 17133 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.40 261.40 0.00 0.00 1.7285 0.0000 1064524
Direct Results Count Pct Average Min Max Total Damage
hit 96.1 36.76% 4206.56 2756 8317 404247
crit 53.3 20.38% 8670.87 5677 17133 461970
glance 62.8 24.04% 3155.46 2067 6238 198307
miss 49.2 18.81% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 2637 9.4% 46.0 9.51sec 25954 17117 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.96 45.96 0.00 0.00 1.5163 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 1619 5.8% 46.0 9.51sec 15939 0 12107 25443 50363 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.96 45.96 0.00 0.00 0.0000 0.0000 732529
Direct Results Count Pct Average Min Max Total Damage
hit 32.8 71.27% 12107.02 8185 24448 396562
crit 13.2 28.73% 25442.96 16861 50363 335967

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 1018 3.6% 46.0 9.51sec 10015 0 7603 15968 31477 28.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.96 45.96 0.00 0.00 0.0000 0.0000 460279
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 71.16% 7602.50 5116 15280 248643
crit 13.3 28.84% 15967.72 10538 31477 211636

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 3069 11.0% 39.2 11.28sec 35446 23458 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.17 39.17 0.00 0.00 1.5110 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 39.2 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1847 6.6% 39.2 11.28sec 21331 0 16332 33873 66299 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.17 39.17 0.00 0.00 0.0000 0.0000 835516
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.50% 16331.93 11199 32184 457382
crit 11.2 28.50% 33873.24 23070 66299 378134

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74
slam_oh 1222 4.4% 39.2 11.28sec 14115 0 10808 22420 43104 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.17 39.17 0.00 0.00 0.0000 0.0000 552851
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.52% 10807.53 7430 20924 302756
crit 11.2 28.48% 22419.64 15305 43104 250096

Action details: slam_oh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_1h_T11_372
bloodthirst rage 47.2% 1590.8 20
colossus_smash rage 7.5% 558.7 20
death_wish rage 0.5% 0.0 7
execute rage 9.9% 1301.3 29
heroic_strike rage 19.5% 1163.0 20
raging_blow rage 15.4% 1352.5 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.2 367.1 30.0 0.0%
berserker_rage rage 6.9 58.5 8.5 0.3%
melee_main_hand rage 212.8 3558.1 16.7 1.0%
melee_off_hand rage 212.2 1780.9 8.4 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 20.2 0.0 21.3sec 21.3sec 8% 8%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 6.9 0.0 55.6sec 55.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.0sec 123.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 39.4 1.1 11.3sec 10.9sec 16% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 14.6 42.0 29.2sec 7.4sec 58% 56%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 18.6 46.4sec 4.6sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 77.8 152.2 5.8sec 2.0sec 70% 69%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.4sec 339.4sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.8sec 104.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.1 0.0 41.1sec 41.1sec 10% 16%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 13.5 13.1 33.1sec 16.4sec 51% 51%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.6 46.3sec 32.6sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.7 44.3 364.4sec 9.5sec 96% 95%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.8%

Procs

Count Interval
munched_deep_wounds 47.9 9.7sec
rolled_deep_wounds 35.2 13.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.73%
σ of the average dps 9.1191
2 * σ / μ 0.0652%
95% Confidence Intervall ( μ ± 2σ ) ( 27975.41 - 28011.89 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27966.29 - 28021.01 )
Sample Data
σ 911.9140
Minimum 24637.94
Maximum 31454.99
Spread ( max - min ) 6817.04
Range ( max - min ) / 2 3408.52
Range% 12.18
10th Percentile 26845.87
90th Percentile 29171.81
( 90th Percentile - 10th Percentile ) 2325.94
Approx. Iterations needed for
1% dps error 42
0.1% dps error 4244
0.1 scale factor error with delta=300 7391
0.05 scale factor error with delta=300 29567
0.01 scale factor error with delta=300 739188
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F slam,if=buff.bloodsurge.react
G execute,if=rage>=50
H berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
I raging_blow
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEFAEIAEEAFEFEIECEFAEFAEIAEJAEFAEIAECAEIAEEIEFEIEECEAFEHIEJAEIEEFECAEFAEFEHIEFEAIEAJEACEAIEAFEAIEEAHIEFECAEIEFEIJEF7EAFEAICEAEIEFEFEAIECEAFEIEJEAFEFEIECAEFEFEIEEIEFECEIEFEIEAJEIEECEFI6EEIEAEAFEAICAEJAEFEAIEAFEIEAECEFAEIEFE7IEFEAIECAEIEJEIEEFAEFAECAEIEEAFEIEJAEHIAECEIEAEEAFEIEFCEAIJEEIEAEFEAICAEFAEIAEFEIEAJEAICAEFEFEFEIEEIECFEHIEJ7EAIBDDDDCEFEBEAGEGEAIEJBCAEGEGEGEIE6GEHIECBEAIEJBEGEGGEICEGEAFEGEGIEGEGCEGEGGEFG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6222 4940 4513
Agility 729 145 20
Stamina 7572 5953 5780
Intellect 55 53 20
Spirit 82 82 20
Health 148963 126367 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 6.10% 6.10% 625
Spell Crit 20.20% 15.20% 2545
Spell Haste 13.93% 8.50% 1089
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14130 10280 190
Melee Hit 8.20% 8.20% 625
Melee Crit 23.19% 15.79% 2545
Melee Haste 8.50% 8.50% 1089
Expertise 26.64 26.64 800
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.51% 12.51% 809

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 0
Single-Minded Fury 1
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_1h_T11_372
origin="http://chardev.org/?profile=36557"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
glyphs=death_wish/cleaving/heroic_throw/battle/berserker_rage/bloody_healing/slam/raging_blow/bloodthirst
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands=plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4513
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=800
# gear_hit_rating=625
# gear_crit_rating=2545
# gear_haste_rating=1089
# gear_mastery_rating=809
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_2h_T11_372 : 27821dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27821.2 18.85 / 0.07% 2189.4 12.7 12.8 rage 8.50% 46.3
Origin http://chardev.org/?profile=36611
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • bloody_healing
  • battle
  • berserker_rage
  • bloodthirst
  • raging_blow
  • slam

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27031|21538|18558|17715|9807|3663|2273&chds=0,54062&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++27031++raging_blow,C79C6E,0,0,15|t++21538++execute,C79C6E,1,0,15|t++18558++bloodthirst,C79C6E,2,0,15|t++17715++slam,C79C6E,3,0,15|t++9807++colossus_smash,C79C6E,4,0,15|t++3663++melee_main_hand,C79C6E,5,0,15|t++2273++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:30,13,12,9,8,7,7,7,4,3&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|raging_blow_mh|heroic_strike|melee_off_hand|raging_blow_oh|deep_wounds|slam_mh|execute|colossus_smash&chtt=Warrior_Fury_2h_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:foqcdaXbnimkkpyuvtrx20ytmkcefow0vx1685zz134xskccabhhiiijlnmmooqsnkgYZZagjjlllpqqrqprrplfZYYZdgghijmnoppqssqmgbaZbehijjkmoooopqqokfbZZbdhiiklmoppnjjkkhdZXXYbdffghjlmmmnoonjfbYYaegijklnoooopqqplhdbacehijklmoopppqpokgdaabdghijkmnpppqqqolhdbabdfhjjkmnopppqpokhdbabdghiklmnoppqqqolhebbbdfhijkmmkihijjigdaZYZacdefgijkkllllkifdbbbdeghhijlmmnooonligeddefgijkllmnoooonljhfeefghijklmnoopppomkigfeefghijklmnnoooomljhgffghijklmmnoopponmkihhghhijjhghijkllmmlkjiihii&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=71&chtt=Warrior_Fury_2h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:7453112010z1110yzxwwvssrrrqopononmmlijhgggffeeedccbbbaaaZZZZZZZZZZZZYZZYZZZZZYZZYZZZZZZZZZZYZZZZZZZZZaaaabbbbbccccddddddddddcccccccbbbbbbbbccddeeffgghhiijjkkkkkkkkkjiihhgffeeddccbbbaaZZYYZZZZYZZZZYZZZZZZZZaaaaabbbbbcccccccddddccccdddddeeeeffffffffffeeeeddcccbbaaaaaaabbbbcccccddddeeeffffffffffffffffffffffffffffffeeeeeeeeeeeeeddddcdddddccccccccccbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbcccdddeeeeffffffffffffffeeeeeeeeeeefffggghhiiijjjkkklllmmmmnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27821|max=54330&chxp=1,1,51,100&chtt=Warrior_Fury_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,6,13,12,18,33,31,54,72,109,151,198,209,271,363,436,468,521,542,639,632,680,638,605,546,471,482,390,323,251,207,180,114,104,77,49,30,19,20,17,3,6,1,2,0,0,0,1,1&chds=0,680&chbh=5&chxt=x&chxl=0:|min=24480|avg=27821|max=31983&chxp=0,1,45,100&chtt=Warrior_Fury_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T11_372 27821
battle_shout 0 0.0% 12.1 37.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.07 12.07 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:The warrior shouts, increasing Strength and Agility of all raid and party members within $a1 yards by $s1 and gaining ${$92049m1/10} rage. Lasts $d.
berserker_rage 0 0.0% 9.5 44.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.54 9.54 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.5 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 8231 29.6% 132.2 3.41sec 28155 18558 20528 42873 94424 34.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.24 132.24 0.00 0.00 1.5171 0.0000 3723129
Direct Results Count Pct Average Min Max Total Damage
hit 87.1 65.87% 20528.24 12557 45837 1788121
crit 45.1 34.13% 42872.89 25867 94424 1935008

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 718 2.6% 21.9 21.11sec 14841 9807 11731 24456 36866 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.88 21.88 0.00 0.00 1.5133 0.0000 324676
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 75.56% 11731.29 8692 17896 193910
crit 5.3 24.44% 24455.90 18203 36866 130766

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass their armor for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage by $s1%. Increases all damage taken by $s3%.
  • description:When activated you become Enraged, increasing your physical damage by $s1% but increasing all damage taken by $s3%. Lasts $d.
deep_wounds 2045 7.4% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 423 2187 0 0.0% 0.0% 93.5%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 183.25 423.10 423.10 0.0000 1.0000 925126
Direct Results Count Pct Average Min Max Total Damage
hit 183.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 423.1 100.00% 2186.54 429 10687 925126

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2651.40
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1187 4.3% 16.5 5.46sec 32523 21538 26186 53704 115844 23.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.51 16.51 0.00 0.00 1.5100 0.0000 536953
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 76.97% 26186.32 6195 56235 332786
crit 3.8 23.03% 53704.07 3294 115844 204167

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2484 8.9% 54.6 8.14sec 20578 0 13895 28701 61587 45.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.61 54.61 0.00 0.00 0.0000 0.0000 1123748
Direct Results Count Pct Average Min Max Total Damage
hit 30.0 54.86% 13895.23 8276 29897 416316
crit 24.6 45.14% 28700.69 17048 61587 707432

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3656 13.1% 176.8 2.57sec 9351 3663 9422 19416 37734 21.2% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.83 176.83 0.00 0.00 2.5530 0.0000 1653511
Direct Results Count Pct Average Min Max Total Damage
hit 66.4 37.53% 9422.26 6171 18317 625257
crit 37.5 21.21% 19416.42 12712 37734 728240
glance 42.4 23.99% 7072.51 4628 13738 300014
miss 30.5 17.28% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2269 8.2% 176.2 2.57sec 5825 2273 5872 12102 23583 21.2% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.17 176.17 0.00 0.00 2.5626 0.0000 1026175
Direct Results Count Pct Average Min Max Total Damage
hit 66.0 37.49% 5872.04 3857 11448 387841
crit 37.3 21.19% 12102.01 7945 23583 451851
glance 42.3 24.01% 4408.26 2893 8586 186483
miss 30.5 17.30% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 5302 19.1% 58.5 7.71sec 41005 27031 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.49 58.49 0.00 0.00 1.5170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 58.5 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 3255 11.7% 58.5 7.71sec 25175 0 18984 39816 75404 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.49 58.49 0.00 0.00 0.0000 0.0000 1472400
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.28% 18983.65 12579 36604 780321
crit 17.4 29.72% 39816.50 25913 75404 692078

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 2047 7.4% 58.5 7.71sec 15830 0 11925 25054 47127 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.49 58.49 0.00 0.00 0.0000 0.0000 925844
Direct Results Count Pct Average Min Max Total Damage
hit 41.1 70.26% 11925.32 7862 22877 490027
crit 17.4 29.74% 25053.71 16196 47127 435817

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Special attacks have an additional $s1% chance to critically hit but all damage taken is increased by $s2%.
  • description:Your special attacks have an additional $s1% to critically hit but all damage taken is increased by $s2%. Lasts $d.
slam 1929 6.9% 32.6 13.48sec 26754 17715 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.61 32.61 0.00 0.00 1.5102 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 32.6 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50783m2% weapon damage plus ${$m1*$50783m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1929 6.9% 32.6 13.48sec 26754 0 20485 42200 85658 28.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.61 32.61 0.00 0.00 0.0000 0.0000 872557
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 71.13% 20484.53 14684 41582 475219
crit 9.4 28.87% 42199.99 30568 85658 397338

Action details: slam_mh

Static Values
  • id:50783
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.74

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_2h_T11_372
bloodthirst rage 46.0% 1407.7 20
colossus_smash rage 7.5% 755.4 20
death_wish rage 0.5% 0.0 7
execute rage 8.1% 1157.4 28
heroic_strike rage 18.4% 1059.8 19
raging_blow rage 19.5% 2135.8 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.1 362.0 30.0 0.0%
berserker_rage rage 9.5 90.9 9.5 1.0%
melee_main_hand rage 146.3 3556.0 24.3 1.6%
melee_off_hand rage 145.7 1789.6 12.3 0.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 19.8 0.0 21.7sec 21.7sec 8% 9%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 9.5 0.0 44.6sec 44.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.2sec 123.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 33.4 6.2 13.3sec 11.2sec 27% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 15.1 30.4 28.2sec 9.1sec 52% 51%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 15.4 46.0sec 5.5sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 49.4 144.8 9.2sec 2.3sec 78% 76%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 338.8sec 338.8sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 105.8sec 105.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.2 0.0 41.0sec 41.0sec 10% 17%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 14.4 20.7 31.4sec 12.6sec 61% 62%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.5 46.1sec 32.7sec 29% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 57.5 381.7sec 7.7sec 99% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.9%

Procs

Count Interval
munched_deep_wounds 34.3 13.5sec
rolled_deep_wounds 31.0 14.8sec

Statistics & Data Analysis

DPS
Population
Convergence 69.96%
σ of the average dps 9.4267
2 * σ / μ 0.0678%
95% Confidence Intervall ( μ ± 2σ ) ( 27802.37 - 27840.08 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27792.95 - 27849.51 )
Sample Data
σ 942.6704
Minimum 24480.46
Maximum 31983.09
Spread ( max - min ) 7502.63
Range ( max - min ) / 2 3751.32
Range% 13.48
10th Percentile 26634.87
90th Percentile 29026.95
( 90th Percentile - 10th Percentile ) 2392.08
Approx. Iterations needed for
1% dps error 45
0.1% dps error 4592
0.1 scale factor error with delta=300 7898
0.05 scale factor error with delta=300 31595
0.01 scale factor error with delta=300 789891
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
G raging_blow
H slam,if=buff.bloodsurge.react
I execute,if=rage>=50
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEGAEEGEHEGEHECEGEHEFGAEAEGAEHEACEAGEAHEGEAEAGEAHEACEGEJEFGEEGEHECAEGAEEGEHAEGEAJEACEAGEAEGEEFGEECEGHEJAEGEH7EGECEGEHEGEEAGEAHCEGEJEFAGEHEGEAECAEGEHEGEHEFGEHAECAEHEGEHEAJEAHEFAGCAEAEG6EHEAEAGEHCEJAFGEAEGEEAGEHCAEHAEHAEGEH7EGEHECEGHJEAGEHEAHEGCEFGEHEGEHEGEJACEAGEHEAFGEHEGEHAECAEGAEHEJAGEEGECEGEEHFEGJCAEGEAHEGEEEFGCAEEGEJE7GBDDDDCEGEBEGEHBEAGEHBCEAGEBEFGEAJB6EGEHBCEAIEIEAGEHBEFGECBEGEHBEAGEHBEAGCEBEAGEHB

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6519 5223 4782
Agility 729 145 20
Stamina 8265 6613 6440
Intellect 55 53 20
Spirit 82 82 20
Health 158665 135607 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 7.87% 7.87% 806
Spell Crit 21.01% 16.01% 2691
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14783 10845 190
Melee Hit 9.71% 9.71% 806
Melee Crit 24.00% 16.61% 2691
Melee Haste 5.13% 5.13% 657
Expertise 26.01 26.01 781
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.51% 16.51% 1526

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 1
Single-Minded Fury 0
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_2h_T11_372
origin="http://chardev.org/?profile=36611"
level=85
race=worgen
role=attack
use_pre_potion=1
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
glyphs=death_wish/cleaving/heroic_throw/bloody_healing/battle/berserker_rage/bloodthirst/raging_blow/slam
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4782
# gear_agility=20
# gear_stamina=6440
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=806
# gear_crit_rating=2691
# gear_haste_rating=657
# gear_mastery_rating=1526
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket1=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Auras/Buffs

Constant Buff
abominations_might
arcane_tactics
battle_shout
communion
demonic_Pact
devotion_aura
elemental_oath
fel_intelligence
ferocious_inspiration
flametongue_totem
honor_among_thieves
horn_of_winter
hunting_party
improved_icy_talons
leader_of_the_pack
mana_spring_totem
mind_quickening
moonkin
qiraji_fortitude
rampage
roar_of_courage
strength_of_earth
trueshot
unleashed_rage
windfury_totem
wrath_of_air

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
0.0 0.00 / 0.00% 0.0 854026.1 0.0 health 100.02% 0.0

Charts

http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t777777666655554444333332222221111110000000zzzzzzzyyyyyyyyxxxxxxxxwwwwwwwvvvvvvvvvuuuuuuuutttttttttssssssssrrrrrrrrqqqqqqqqppppppppooooooonnnnnnnnmmmmmmmmllllllllkkkkkkkkkjjjjjjjjiiiiiiiiihhhhhhhhgggggggfffffffffeeeeeeeeddddddddcccccccbbbbbbbbaaaaaaaaZZZZZZZZYYYYYYYYXXXXXXXXWWWWWWWWVVVVVVVVUUUUUUUUTTTTTTTTTSSSSSSSSRRRRRRRRQQQQQQQQPPPPPPPPOOOOOOOONNNNNNNNMMMMMMMMMMMMLLLLLLLLLLLLLLKKKKKKKKKKKKKKKJJJJJJJJJJJJJJIIIIIIIIIIIIIIIHHHHHHHHHHHHHHHGGGGGGGGGGG&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=385657691&chtt=Fluffy_Pillow+Health+Timeline&chts=dddddd,18&chco=336600 http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=0|max=0&chxp=1,1,-nan,100&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18

Abilities

Resources

Resource Usage Type Res% DPR RPE
Fluffy_Pillow
Resource Gains Type Count health Average Overflow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs
bleeding

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_bleed

Database details

  • id:
  • cooldown name:buff_blood_frenzy_bleed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_physical

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
brittle_bones

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
corrosive_spit

Database details

  • id:95466
  • cooldown name:buff_corrosive_spit
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
critical_mass

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:Spells have a $s1% additional chance to critically hit.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
curse_of_elements

Database details

  • id:
  • cooldown name:buff_curse_of_elements
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_roar

Database details

  • id:99
  • cooldown name:buff_demoralizing_roar
  • tooltip:Reduces physical damage caused by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_screech

Database details

  • id:24423
  • cooldown name:buff_demoralizing_screech
  • tooltip:Physical damage reduced by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
demoralizing_shout

Database details

  • id:
  • cooldown name:buff_demoralizing_shout
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
earth_and_moon

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
ebon_plague

Database details

  • id:
  • cooldown name:buff_ebon_plague
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
expose_armor

Database details

  • id:
  • cooldown name:buff_expose_armor
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
faerie_fire

Database details

  • id:91565
  • cooldown name:buff_faerie_fire
  • tooltip:Armor reduced by $s1%. Cannot stealth or turn invisible.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
hemorrhage

Database details

  • id:
  • cooldown name:buff_hemorrhage
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
hunters_mark

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
infected_wounds

Database details

  • id:
  • cooldown name:buff_infected_wounds
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_just

Database details

  • id:
  • cooldown name:buff_judgements_of_the_just
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_breath

Database details

  • id:24844
  • cooldown name:buff_lightning_breath
  • tooltip:Increases magic damage taken by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
mangle

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
master_poisoner

Database details

  • id:
  • cooldown name:buff_master_poisoner
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
poisoned

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ravage

Database details

  • id:50518
  • cooldown name:buff_ravage
  • tooltip:Increases physical damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
savage_combat

Database details

  • id:
  • cooldown name:buff_savage_combat
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
scarlet_fever

Database details

  • id:
  • cooldown name:buff_scarlet_fever
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_and_flame

Database details

  • id:17800
  • cooldown name:buff_shadow_and_flame
  • tooltip:Chance to be critically hit with spells increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sunder_armor

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
tailspin

Database details

  • id:90315
  • cooldown name:buff_tailspin
  • tooltip:Melee and ranged attack speed reduced by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tear_armor

Database details

  • id:95467
  • cooldown name:buff_tear_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
tendon_rip

Database details

  • id:50271
  • cooldown name:buff_tendon_rip
  • tooltip:All bleed effects cause $s1% additional damage.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
thunder_clap

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vindication

Database details

  • id:
  • cooldown name:buff_vindication
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 0.00%
σ of the average dps 0.0000
2 * σ / μ 0.0000%
95% Confidence Intervall ( μ ± 2σ ) ( 0.00 - 0.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 0.00% - 0.00% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 0.00 - 0.00 )
Sample Data
σ 0.0000
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range ( max - min ) / 2 0.00
Range% 0.00
10th Percentile 0.00
90th Percentile 0.00
( 90th Percentile - 10th Percentile ) 0.00
Approx. Iterations needed for
1% dps error 0
0.1% dps error 0
0.1 scale factor error with delta=300 0
0.05 scale factor error with delta=300 0
0.01 scale factor error with delta=300 0
DPS Timeline Chart

Action Priority List

# action,conditions
0 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 461530333 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 8.00% 8.00% 0

Gear

Encoded
head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty

Talents

Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Improved Cower 0
Bloodthirsty 0
Spiked Collar 0
Boar's Speed 0
Culling the Herd 0
Lionhearted 0
Swoop 0
Charge 0
Heart of the Phoenix 0
Spider's Bite 0
Great Resistance 0
Rabid 0
Lick Your Wounds 0
Call of the Wild 0
Shark Attack 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Charge 0
Great Stamina 0
Natural Armor 0
Spiked Collar 0
Boar's Speed 0
Blood of the Rhino 0
Pet Barding 0
Culling the Herd 0
Guard Dog 0
Lionhearted 0
Thunderstomp 0
Grace of the Mantis 0
Great Resistance 0
Last Stand 0
Taunt 0
Roar of Sacrifice 0
Intervene 0
Silverback 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Boar's Speed 0
Mobility 0
Mobility 0
Owl's Focus 0
Spiked Collar 0
Culling the Herd 0
Lionhearted 0
Carrion Feeder 0
Great Resistance 0
Cornered 0
Feeding Frenzy 0
Wolverine Bite 0
Roar of Recovery 0
Bullheaded 0
Grace of the Mantis 0
Wild Hunt 0
Roar of Sacrifice 0

Profile

#!./simc

enemy=Fluffy_Pillow
origin="unknown"
level=88
race=humanoid
role=tank
use_pre_potion=1
talents=http://www.wowhead.com/talent#enemy-000000000000000000000000000000000000000000000000000000000000000
actions=snapshot_stats
# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per second.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg

Convergence

Rate at which multipling iterations by convergence_scale reduces error

For default convergence_scale=2 it should itself approach 70.71% according to the central limit theorem

G%

Percentage of executes that resulted in glancing blows.

G%

Percentage of executes that resulted in blocking blows.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Max

Maximum crit damage over all iterations.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps_max - dps_min ) / ( 2 * dps_avg )

RPS In

Average resource points generated per second.

RPS Out

Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.